Recombinant Full Length Human SYT2 Protein, C-Flag-tagged
Cat.No. : | SYT2-1027HFL |
Product Overview : | Recombinant Full Length Human SYT2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a synaptic vesicle membrane protein. The encoded protein is thought to function as a calcium sensor in vesicular trafficking and exocytosis. Mutations in this gene are associated with myasthenic syndrome, presynaptic, congenital, with or without motor neuropathy. Alternative splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 46.7 kDa |
AA Sequence : | MRNIFKRNQEPIVAPATTTATMPIGPVDNSTESGGAGESQEDMFAKLKEKLFNEINKIPLPPWALIAIAV VAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENL GKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTF KVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRY VPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQI QKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein, Transmembrane |
Full Length : | Full L. |
Gene Name | SYT2 synaptotagmin 2 [ Homo sapiens (human) ] |
Official Symbol | SYT2 |
Synonyms | CMS7; CMS7A; CMS7B; MYSPC; SytII |
Gene ID | 127833 |
mRNA Refseq | NM_001136504.1 |
Protein Refseq | NP_001129976.1 |
MIM | 600104 |
UniProt ID | Q8N9I0 |
◆ Recombinant Proteins | ||
SYT2-1027HFL | Recombinant Full Length Human SYT2 Protein, C-Flag-tagged | +Inquiry |
SYT2-16334M | Recombinant Mouse SYT2 Protein | +Inquiry |
SYT2-3083H | Recombinant Human SYT2, GST-tagged | +Inquiry |
Syt2-4938R | Recombinant Rat Syt2 Full Length Transmembrane protein, His-tagged | +Inquiry |
SYT2-2150H | Recombinant Human SYT2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SYT2-646HCL | Recombinant Human SYT2 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SYT2 Products
Required fields are marked with *
My Review for All SYT2 Products
Required fields are marked with *
0
Inquiry Basket