Recombinant Rat Syt2 Full Length Transmembrane protein, His-tagged

• Cat.No.: Syt2-4938R
• Product Overview: Recombinant Rat Syt2 protein(P29101)(1-422aa), fused with N-terminal His tag, was expressed in in vitro E. coli expression system.

Specification

• Source: In vitro E. coli expression system
• Species: Rat
• Tag: His
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol.
  If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 48.7 kDa
• Protein length: 1-422aa
• AA Sequence: MRNIFKRNQEPIVAPATTTATMPLAPAAPADNSTESTGTGESQEDMFAKLKDKFFNEINKIPLPPWALIAMAVVAGLLLLTCCFCICKKCCCKKKKNKKEKGKGMKNAMNMKDMKGGQDDDDAETGLTEGEGEGEEEKEPENLGKLQFSLDYDFQANQLTVGVLQAAELPALDMGGTSDPYVKVFLLPDKKKKYETKVHRKTLNPAFNETFTFKVPYQELGGKTLVMAIYDFDRFSKHDIIGEVKVPMNTVDLGQPIEEWRDLQGGEKEEPEKLGDICTSLRYVPTAGKLTVCILEAKNLKKMDVGGLSDPYVKIHLMQNGKRLKKKKTTVKKKTLNPYFNESFSFEIPFEQIQKVQVVVTVLDYDKLGKNEAIGKIFVGSNATGTELRHWSDMLANPRRPIAQWHSLKPEEEVDALLGKNK
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: Syt2 synaptotagmin II [ Rattus norvegicus ]
• Official Symbol: Syt2
• Synonyms: SYT2; synaptotagmin II; synaptotagmin-2; sytII; synaptotagmin 2; SYNII; RATSYNII
• Gene ID: 24805
• mRNA Refseq: NM_012665
• Protein Refseq: NP_036797