Recombinant Full Length Human Small Conductance Calcium-Activated Potassium Channel Protein 1(Kcnn1) Protein, His-Tagged
Cat.No. : | RFL2955HF |
Product Overview : | Recombinant Full Length Human Small conductance calcium-activated potassium channel protein 1(KCNN1) Protein (Q92952) (1-543aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-543) |
Form : | Lyophilized powder |
AA Sequence : | MNSHSYNGSVGRPLGSGPGALGRDPPDPEAGHPPQPPHSPGLQVVVAKSEPARPSPGSPR GQPQDQDDDEDDEEDEAGRQRASGKPSNVGHRLGHRRALFEKRKRLSDYALIFGMFGIVV MVTETELSWGVYTKESLYSFALKCLISLSTAILLGLVVLYHAREIQLFMVDNGADDWRIA MTCERVFLISLELAVCAIHPVPGHYRFTWTARLAFTYAPSVAEADVDVLLSIPMFLRLYL LGRVMLLHSKIFTDASSRSIGALNKITFNTRFVMKTLMTICPGTVLLVFSISSWIIAAWT VRVCERYHDKQEVTSNFLGAMWLISITFLSIGYGDMVPHTYCGKGVCLLTGIMGAGCTAL VVAVVARKLELTKAEKHVHNFMMDTQLTKRVKNAAANVLRETWLIYKHTRLVKKPDQARV RKHQRKFLQAIHQAQKLRSVKIEQGKLNDQANTLTDLAKTQTVMYDLVSELHAQHEELEA RLATLESRLDALGASLQALPGLIAQAIRPPPPPLPPRPGPGPQDQAARSSPCRWTPVAPS DCG |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | KCNN1 |
Synonyms | KCNN1; SK; Small conductance calcium-activated potassium channel protein 1; SK1; SKCa 1; SKCa1; KCa2.1 |
UniProt ID | Q92952 |
◆ Recombinant Proteins | ||
RGS3-2280H | Recombinant Human RGS3, GST-tagged | +Inquiry |
ELAC2-2073R | Recombinant Rat ELAC2 Protein | +Inquiry |
acpP-5478S | Recombinant Staph acpP protein, GST-tagged | +Inquiry |
STPG2-8823M | Recombinant Mouse STPG2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRYBB1-5754C | Recombinant Chicken CRYBB1 | +Inquiry |
◆ Native Proteins | ||
AMY1A-8022H | Native Human Salivary Amylase | +Inquiry |
HYAL1-39B | Active Native Bovine Hyaluronidase | +Inquiry |
HP-75C | Native Canine Haptoglobin | +Inquiry |
Collagen Type IV-09H | Native Human Collagen Type IV | +Inquiry |
Lectin-1826P | Active Native Phaseolus Vulgaris Leucoagglutinin Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ART4-1541MCL | Recombinant Mouse ART4 cell lysate | +Inquiry |
CYP7B1-7098HCL | Recombinant Human CYP7B1 293 Cell Lysate | +Inquiry |
MMP20-4276HCL | Recombinant Human MMP20 293 Cell Lysate | +Inquiry |
CSF2-3008HCL | Recombinant Human CSF2 cell lysate | +Inquiry |
ENO3-248HCL | Recombinant Human ENO3 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All KCNN1 Products
Required fields are marked with *
My Review for All KCNN1 Products
Required fields are marked with *
0
Inquiry Basket