Recombinant Full Length Human SCGB2A1 Protein, GST-tagged

• Cat.No.: SCGB2A1-29236TH
• Product Overview: Recombinant full length Human Mammaglobin B with an N-terminal proprietary tag; Predicted MW 36.52 kDa

Specification

• Product Overview: Recombinant full length Human Mammaglobin B with an N-terminal proprietary tag; Predicted MW 36.52 kDa
• Protein length: 1-95 a.a.
• Molecular Weight: 36.520kDa
• Source: Wheat germ
• Tissue specificity: Expressed in thymus, trachea, kidney, steroid responsive tissues (prostate, testis, uterus, breast and ovary) and salivary gland.
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MKLLMVLMLAALLLHCYADSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN
• Sequence Similarities: Belongs to the secretoglobin family. Lipophilin subfamily.
• Tag: Non

Gene Information

• Gene Name: SCGB2A1 secretoglobin, family 2A, member 1 [ Homo sapiens ]
• Official Symbol: SCGB2A1
• Synonyms: SCGB2A1; secretoglobin, family 2A, member 1; mammaglobin 2 , MGB2; mammaglobin-B; lacryglobin; lipophilin C; LPHC; mammaglobin B; MGC71973; UGB3
• Gene ID: 4246
• mRNA Refseq: NM_002407
• Protein Refseq: NP_002398
• MIM: 604398
• Uniprot ID: O75556
• Chromosome Location: 11q13
• Function: androgen binding; binding