Recombinant Full Length Human RFX3 Protein, C-Flag-tagged
Cat.No. : | RFX3-1622HFL |
Product Overview : | Recombinant Full Length Human RFX3 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene is a member of the regulatory factor X gene family, which encodes transcription factors that contain a highly-conserved winged helix DNA binding domain. The protein encoded by this gene is structurally related to regulatory factors X1, X2, X4, and X5. It is a transcriptional activator that can bind DNA as a monomer or as a heterodimer with other RFX family members. Multiple transcript variants encoding different isoforms have been described for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 83.3 kDa |
AA Sequence : | MQTSETGSDTGSTVTLQTSVASQAAVPTQVVQQVPVQQQVQQVQTVQQVQHVYPAQVQYVEGSDTVYTNG AIRTTTYPYTETQMYSQNTGGNYFDTQGSSAQVTTVVSSHSMVGTGGIQMGVTGGQLISSSGGTYLIGNS MENSGHSVTHTTRASPATIEMAIETLQKSDGLSTHRSSLLNSHLQWLLDNYETAEGVSLPRSTLYNHYLR HCQEHKLDPVNAASFGKLIRSIFMGLRTRRLGTRGNSKYHYYGIRVKPDSPLNRLQEDMQYMAMRQQPMQ QKQRYKPMQKVDGVADGFTGSGQQTGTSVEQTVIAQSQHHQQFLDASRALPEFGEVEISSLPDGTTFEDI KSLQSLYREHCEAILDVVVNLQFSLIEKLWQTFWRYSPSTPTDGTTITESSNLSEIESRLPKAKLITLCK HESILKWMCNCDHGMYQALVEILIPDVLRPIPSALTQAIRNFAKSLEGWLSNAMNNIPQRMIQTKVAAVS AFAQTLRRYTSLNHLAQAARAVLQNTSQINQMLSDLNRVDFANVQEQASWVCQCDDNMVQRLETDFKMTL QQQSTLEQWAAWLDNVMMQALKPYEGRPSFPKAARQFLLKWSFYSSMVIRDLTLRSAASFGSFHLIRLLY DEYMFYLVEHRVAQATGETPIAVMGEFGDLNAVSPGNLDKDEGSEVESEMDEELDDSSEPQAKREKTELS QAFPVGCMQPVLETGVQPSLLNPIHSEHIVTSTQTIRQCSATGNTYTAVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transcription Factors |
Full Length : | Full L. |
Gene Name | RFX3 regulatory factor X3 [ Homo sapiens (human) ] |
Official Symbol | RFX3 |
Synonyms | bA32F11.1 |
Gene ID | 5991 |
mRNA Refseq | NM_134428.3 |
Protein Refseq | NP_602304.1 |
MIM | 601337 |
UniProt ID | P48380 |
◆ Recombinant Proteins | ||
RFX3-1622HFL | Recombinant Full Length Human RFX3 Protein, C-Flag-tagged | +Inquiry |
RFX3-4990Z | Recombinant Zebrafish RFX3 | +Inquiry |
RFX3-1021H | Recombinant Human RFX3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
Rfx3-5481M | Recombinant Mouse Rfx3 Protein, Myc/DDK-tagged | +Inquiry |
RFX3-2265H | Recombinant Human RFX3, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
RFX3-2398HCL | Recombinant Human RFX3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All RFX3 Products
Required fields are marked with *
My Review for All RFX3 Products
Required fields are marked with *
0
Inquiry Basket