Recombinant Full Length Human RAD52, GST-tagged

• Cat.No.: RAD52-2668H
• Product Overview: Recombinant Human RAD52 (1 a.a. - 418 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Description: The protein encoded by this gene shares similarity with Saccharomyces cerevisiae Rad52, a protein important for DNA double-strand break repair and homologous recombination. This gene product was shown to bind single-stranded DNA ends, and mediate the DNA-DNA interaction necessary for the annealing of complementary DNA strands. It was also found to interact with DNA recombination protein RAD51, which suggested its role in RAD51 related DNA recombination and repair.
• Source: Wheat germ
• Species: Human
• Tag: GST
• Molecular Mass: 46 kDa
• AA Sequence: MSGTEEAILGGRDSHPAAGGGSVLCFGQCQYTAEEYQAIQKALRQRLGPEYISSRMAGGGQKVCYIEGHRVINLA NEMFGYNGWAHSITQQNVDFVDLNNGKFYVGVCAFVRVQLKDGSYHEDVGYGVSEGLKSKALSLEKARKEAVTDG LKRALRSFGNALGNCILDKDYLRSLNKLPRQLPLEVDLTKAKRQDLEPSVEEARYNSCRPNMALGHPQLQQVTSP SRPSHAVIPADQDCSSRSLSSSAVESEATHQRKLRQKQLQQQFRERMEKQQVRVSTPSAEKSEAAPPAPPVTHST PVTVSEPLLEKDFLAGVTQELIKTLEDNSEKWAVTPDAGDGVVKPSSRADPAQTSDTLALNNQMVTQNRTPHSVC HQKPQAKSGSWDLQTYSADQRTTGNWESHRKSQDMKKRKYDPS
• Applications: ELISA; WB-Re; AP; Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80°C. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: RAD52 RAD52 homolog (S. cerevisiae) [ Homo sapiens ]
• Official Symbol: RAD52
• Synonyms: RAD52; RAD52 homolog (S. cerevisiae); DNA repair protein RAD52 homolog; recombination protein RAD52; rhabdomyosarcoma antigen MU-RMS-40.23
• Gene ID: 5893
• mRNA Refseq: NM_134424
• Protein Refseq: NP_602296
• MIM: 600392
• UniProt ID: P43351
• Chromosome Location: 12p13-p12.2
• Pathway: Assembly of the RAD51-ssDNA nucleoprotein complex; DNA damage response; Double-Strand Break Repair
• Function: DNA binding; identical protein binding; protein binding