Recombinant Full Length Human PYCR2 Protein, C-Flag-tagged

Cat.No. : PYCR2-2161HFL
Product Overview : Recombinant Full Length Human PYCR2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Description : This gene belongs to the pyrroline-5-carboxylate reductase family. The encoded mitochondrial protein catalyzes the conversion of pyrroline-5-carboxylate to proline, which is the last step in proline biosynthesis. Alternatively spliced transcript variants have been described for this gene.
Source : Mammalian cells
Species : Human
Tag : Flag
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 33.5 kDa
AA Sequence : MSVGFIGAGQLAYALARGFTAAGILSAHKIIASSPEMNLPTVSALRKMGVNLTRSNKETVKHSDVLFLAV KPHIIPFILDEIGADVQARHIVVSCAAGVTISSVEKKLMAFQPAPKVIRCMTNTPVVVQEGATVYATGTH ALVEDGQLLEQLMSSVGFCTEVEEDLIDAVTGLSGSGPAYAFMALDALADGGVKMGLPRRLAIQLGAQAL LGAAKMLLDSEQHPCQLKDNVCSPGGATIHALHFLESGGFRSLLINAVEASCIRTRELQSMADQEKISPA ALKKTLLDRVKLESPTVSTLTPSSPGKLLTRSLALGGKKD myc-FLAG tag
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Pathways : Arginine and proline metabolism, Metabolic pathways
Full Length : Full L.
Gene Name PYCR2 pyrroline-5-carboxylate reductase 2 [ Homo sapiens (human) ]
Official Symbol PYCR2
Synonyms HLD10; P5CR2
Gene ID 29920
mRNA Refseq NM_013328.4
Protein Refseq NP_037460.2
MIM 616406
UniProt ID Q96C36

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PYCR2 Products

Required fields are marked with *

My Review for All PYCR2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon