Recombinant Full Length Human PRKRA Protein, C-Flag-tagged

• Cat.No.: PRKRA-1175HFL
• Product Overview: Recombinant Full Length Human PRKRA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Species: Human
• Source: Mammalian Cells
• Tag: Flag
• Description: This gene encodes a protein kinase activated by double-stranded RNA which mediates the effects of interferon in response to viral infection. Mutations in this gene have been associated with dystonia. Alternative splicing results in multiple transcript variants.
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 34.2 kDa
• AA Sequence: MSQSRHRAEAPPLEREDSGTFSLGKMITAKPGKTPIQVLHEYGMKTKNIPVYECERSDVQIHVPTFTFRV TVGDITCTGEGTSKKLAKHRAAEAAINILKANASICFAVPDPLMPDPSKQPKNQLNPIGSLQELAIHHGW RLPEYTLSQEGGPAHKREYTTICRLESFMETGKGASKKQAKRNAAEKFLAKFSNISPENHISLTNVVGHS LGCTWHSLRNSPGEKINLLKRSLLSIPNTDYIQLLSEIAKEQGFNITYLDIDELSANGQYQCLAELSTSP
  ITVCHGSGISCGNAQSDAAHNALQYLKIIAERKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome
• Full Length: Full L.

Gene Information

• Gene Name: PRKRA protein activator of interferon induced protein kinase EIF2AK2 [ Homo sapiens (human) ]
• Official Symbol: PRKRA
• Synonyms: RAX; PACT; DYT16; HSD14
• Gene ID: 8575
• mRNA Refseq: NM_003690.5
• Protein Refseq: NP_003681.1
• MIM: 603424
• UniProt ID: O75569