Recombinant Full Length Human PPP4R3A Protein, C-Flag-tagged
Cat.No. : | PPP4R3A-1557HFL |
Product Overview : | Recombinant Full Length Human PPP4R3A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to act upstream of or within positive regulation of gluconeogenesis and protein dephosphorylation. Located in cytosol and nuclear speck. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 93.7 kDa |
AA Sequence : | MTDTRRRVKVYTLNEDRQWDDRGTGHVSSGYVERLKGMSLLVRAESDGSLLLESKINPNTAYQKQQDTLI VWSEAENYDLALSFQEKAGCDEIWEKICQVQGKDPSVDITQDLVDESEEERFDDMSSPGLELPSCELSRL EEIAELVASSLPSPLRREKLALALENEGYIKKLLELFHVCEDLENIEGLHHLYEIIKGIFLLNRTALFEV MFSEECIMDVIGCLEYDPALSQPRKHREFLTKTAKFKEVIPISDPELKQKIHQTYRVQYIQDMVLPTPSV FEENMLSTLHSFIFFNKVEIVGMLQEDEKFLTDLFAQLTDEATDEEKRQELVNFLKEFCAFSQTLQPQNR DAFFKTLSNMGILPALEVILGMDDTQVRSAATDIFSYLVEYNPSMVREFVMQEAQQNDDDILLINLIIEH MICDTDPELGGAVQLMGLLRTLVDPENMLATANKTEKTEFLGFFYKHCMHVLTAPLLANTTEDKPSKDDF QTAQLLALVLELLTFCVEHHTYHIKNYIINKDILRRVLVLMASKHAFLALCALRFKRKIIGLKDEFYNRY IMKSFLFEPVVKAFLNNGSRYNLMNSAIIEMFEFIRVEDIKSLTAHVIENYWKALEDVDYVQTFKGLKLR FEQQRERQDNPKLDSMRSILRNHRYRRDARTLEDEEEMWFNTDEDDMEDGEAVVSPSDKTKNDDDIMDPI SKFMERKKLKESEEKEVLLKTNLSGRQSPSFKLSLSSGTKTNLTSQSSTTNLPGSPGSPGSPGSPGSPGS VPKNTSQTAAITTKGGLVGLVDYPDDDEDDDEDEDKEDTLPLSKKAKFDSTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | PPP4R3A protein phosphatase 4 regulatory subunit 3A [ Homo sapiens (human) ] |
Official Symbol | PPP4R3A |
Synonyms | smk1; FLFL1; PP4R3; SMEK1; smk-1; PP4R3A; MSTP033; KIAA2010 |
Gene ID | 55671 |
mRNA Refseq | NM_001284280.2 |
Protein Refseq | NP_001271209.1 |
MIM | 610351 |
UniProt ID | Q6IN85 |
◆ Recombinant Proteins | ||
CNTF-02H | Recombinant Human CNTF Protein | +Inquiry |
RFL34444CF | Recombinant Full Length Chlorobaculum Parvum Glycerol-3-Phosphate Acyltransferase(Plsy) Protein, His-Tagged | +Inquiry |
ART5-33H | Recombinant Human ART5, His-tagged | +Inquiry |
MFAP4-29207TH | Recombinant Human MFAP4, FLAG-tagged | +Inquiry |
PKIA-6783M | Recombinant Mouse PKIA Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Native Proteins | ||
F11-2466H | Native Human Coagulation Factor XI | +Inquiry |
ALPL-8004H | Native Human Liver Alkaline Phosphatase | +Inquiry |
GPT-188S | Active Native Swine Glutamate Pyruvate Transaminase | +Inquiry |
a-Macroglobulin-535H | Active Native Human a-Macroglobulin | +Inquiry |
CA 19-9-135 | Active Native Human CA 19-9 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KIR3DL1-935HCL | Recombinant Human KIR3DL1 cell lysate | +Inquiry |
SLMO1-612HCL | Recombinant Human SLMO1 lysate | +Inquiry |
WDR41-1927HCL | Recombinant Human WDR41 cell lysate | +Inquiry |
MAPT-4478HCL | Recombinant Human MAPT 293 Cell Lysate | +Inquiry |
CENPC1-7585HCL | Recombinant Human CENPC1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All PPP4R3A Products
Required fields are marked with *
My Review for All PPP4R3A Products
Required fields are marked with *
0
Inquiry Basket