Recombinant Human ART5, His-tagged
Cat.No. : | ART5-33H |
Product Overview : | Recombinant Human Ecto-ADP-Ribosyltransferase 5/ART5 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Met1-Pro291) of Human ART5 fused with a polyhistidine tag at the C-terminus. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
Protein Length : | 1-291 a.a. |
Description : | Ecto-ADP-Ribosyltransferase 5 (ART5) is a member of the ARG-specific ADP-ribosyltransferase family. Members of this family regulate the function of target proteins by attaching ADP-ribose to specific amino acid residues in their target proteins. ART5 is a secreted protein and contains four NAD binding sites. ART5 proposes to regulate the endocytosis of plasma membrane proteins by recruiting the ubiquitin ligase Rsp5p to its target in the plasma membrane. |
AA Sequence : | VPTILPLGLAPDTFDDTYVGCAEEMEEKAAPLLKEEMAHHALLRESWEAAQETWEDKRRGLTLPP GFKAQNGIAIMVYTNSSNTLYWELNQAVRTGGGSRELYMRHFPFKALHFYLIRALQLLRGSGGCS RGPGEVVFRGVGSLRFEPKRLGDSVRLGQFASSSLDKAVAHRFGNATLFSLTTCFGAPIQAFSVF PKEREVLIPPHEVFLVTRFSQDGAQSLVTLWSYNQTCSHFNCAYLGGEKRRGCVSAPGALGTGDL HMTKRHLQQP |
Endotoxin : | Less than 0.1 ng/μg (1 IEU/μg). |
Purity : | Greater than 95% as determined by reducing SDS-PAGE. |
Gene Name | ART5 ADP-ribosyltransferase 5 [ Homo sapiens ] |
Official Symbol | ART5 |
Synonyms | ART5; ADP-ribosyltransferase 5; ecto-ADP-ribosyltransferase 5; mono(ADP-ribosyl)transferase 5; NAD(P)(+)--arginine ADP-ribosyltransferase 5; MGC22848; |
Gene ID | 116969 |
mRNA Refseq | NM_001079536 |
Protein Refseq | NP_001073004 |
MIM | 610625 |
UniProt ID | Q96L15 |
Chromosome Location | 11p15.4 |
Function | NAD(P)+-protein-arginine ADP-ribosyltransferase activity; NAD+ ADP-ribosyltransferase activity; NAD+ nucleosidase activity; transferase activity, transferring glycosyl groups; |
◆ Recombinant Proteins | ||
ART5-420R | Recombinant Rhesus monkey ART5 Protein, His-tagged | +Inquiry |
ART5-33H | Recombinant Human ART5, His-tagged | +Inquiry |
Art5-250R | Recombinant Rat Art5 Protein, His-tagged | +Inquiry |
ART5-765M | Recombinant Mouse ART5 Protein, His (Fc)-Avi-tagged | +Inquiry |
ART5-249R | Recombinant Rhesus Macaque ART5 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ART5-8671HCL | Recombinant Human ART5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ART5 Products
Required fields are marked with *
My Review for All ART5 Products
Required fields are marked with *
0
Inquiry Basket