Recombinant Full Length Human PLA2G15 Protein, GST-tagged

• Cat.No.: PLA2G15-6243HF
• Product Overview: Human LYPLA3 full-length ORF ( NP_036452.1, 1 a.a. - 412 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 412 amino acids
• Description: Lysophospholipases are enzymes that act on biological membranes to regulate the multifunctional lysophospholipids. The protein encoded by this gene hydrolyzes lysophosphatidylcholine to glycerophosphorylcholine and a free fatty acid. This enzyme is present in the plasma and thought to be associated with high-density lipoprotein. A later paper contradicts the function of this gene. It demonstrates that this gene encodes a lysosomal enzyme instead of a lysophospholipase and has both calcium-independent phospholipase A2 and transacylase activities. [provided by RefSeq
• Molecular Mass: 73.1 kDa
• AA Sequence: MGLHLRPYRVGLLPDGLLFLLLLLMLLADPALPAGRHPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKKTESYFTIWLNLELLLPVIIDCWIDNIRLVYNKTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKDKYIRAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNYTWSPEKVFVQTPTINYTLRDYRKFFQDIGFEDGWLMRQDTEGLVEATMPPGVQLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLKSALQCQAWQSRQEHQVLLQELPGSEHIEMLANATTLAYLKRVLLGP
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: PLA2G15 phospholipase A2, group XV [ Homo sapiens ]
• Official Symbol: PLA2G15
• Synonyms: PLA2G15; phospholipase A2, group XV; LYPLA3, lysophospholipase 3 (lysosomal phospholipase A2); group XV phospholipase A2; GXVPLA2; LLPL; 1-O-acylceramide synthase; lysosomal phospholipase A2; LCAT-like lysophospholipase; lysophospholipase 3 (lysosomal phospholipase A2); ACS; LPLA2; LYPLA3; DKFZp564A0122
• Gene ID: 23659
• mRNA Refseq: NM_012320
• Protein Refseq: NP_036452
• MIM: 609362
• UniProt ID: Q8NCC3