Recombinant Rat Pla2g15 protein, His&Myc-tagged

• Cat.No.: Pla2g15-434R
• Product Overview: Recombinant Rat Pla2g15 protein(Q675A5)(34-413aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli.

Specification

• Species: Rat
• Source: E.coli
• Tag: His&Myc
• Protein Length: 34-413aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 51.0 kDa
• Purity: Greater than 90% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
• AA Sequence: AQRHPPVVLVPGDLGNQLEAKLDKPKVVHYLCSKRTDSYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRTTQFPDGVDVRVPGFGETFSLEFLDPSKRNVGSYFYTMVESLVGWGYTRGEDVRGAPYDWRRAPNENGPYFLALQEMIEEMYQMYGGPVVLVAHSMGNMYMLYFLQRQPQAWKDKYIQAFVSLGAPWGGVAKTLRVLASGDNNRIPVIGPLKIREQQRSAVSTSWLLPYNHTWSHEKVFVYTPTANYTLRDYHRFFQDIGFEDGWFMRQDTQGLVEALVPPGVELHCLYGTGVPTPNSFYYENFPDRDPKICFGDGDGTVNLESVLQCQAWQSRQEHKVSLQELPGSEHIEMLANATTLAYLKRVLLEEP

Gene Information

• Gene Name: Pla2g15 phospholipase A2, group XV [ Rattus norvegicus ]
• Official Symbol: Pla2g15
• Synonyms: PLA2G15; phospholipase A2, group XV; group XV phospholipase A2; lysophospholipase 3; 1-O-acylceramide synthase; lysosomal phospholipase A2; LCAT-like lysophospholipase; ACS; LLPL; LPLA2; Lypla3; MGC114208; 1-O-acylceramidesynthase
• Gene ID: 361401
• mRNA Refseq: NM_001004277
• Protein Refseq: NP_001004277