Recombinant Dog PLA2G15 protein, His&Myc-tagged

Cat.No. : PLA2G15-4471D
Product Overview : Recombinant Dog PLA2G15 protein(Q6XPZ3)(32-408aa), fused to N-terminal His tag and C-terminal Myc tag, was expressed in Insect cell.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Dog
Source : Insect Cells
Tag : His&Myc
Protein Length : 32-408aa
Form : If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Molecular Mass : 46.8 kDa
AA Sequence : RRPPVVLVPGDLGNQLEAKLDKPTVVHYLCSKRTESYFTLWLNLELLLPVIIDCWIDNIRLVYNRTSRATQFPDGVDVRVPGFGKTFSLEFLDPSKSSVGSYFHTMVESLVDWGYIRGEDVRGAPYDWRRAPNENGPYFLALREMIEEMYQLYGGPVVLVAHSMGNMYTLYFLQRQPQAWKNKYIQAFVALGAPWGGVAKTLRVLASGDNNRIPVIRPLKIREQQRSAVSTSWLLPYNYTWSPEKIFVHTPTANYTLRDYHQFFQDIGFKDGWLMRQDTEGLVEAMVPPGVPLHCLYGTGVPTPDSFYYESFPDRDPKICFGDGDGTVNLQSALQCQAWRGHQEHQVSLQALPGSEHIEMLANATTLAYLKRVLLGP
Purity : Greater than 85% as determined by SDS-PAGE.
Storage : Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
Reconstitution : Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.
Gene Name PLA2G15 phospholipase A2, group XV [ Canis lupus familiaris ]
Official Symbol PLA2G15
Synonyms PLA2G15; phospholipase A2, group XV; group XV phospholipase A2; 1-O-acylceramide synthase; lysosomal phospholipase A2; LCAT-like lysophospholipase; lysophospholipase 3 (lysosomal phospholipase A2); ACS; LLPL; LPLA2; LYPLA3;
Gene ID 403403
mRNA Refseq NM_001002940
Protein Refseq NP_001002940

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All PLA2G15 Products

Required fields are marked with *

My Review for All PLA2G15 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon