Recombinant Full Length Newcastle Disease Virus Hemagglutinin-Neuraminidase(Hn) Protein, His-Tagged
Cat.No. : | RFL28339NF |
Product Overview : | Recombinant Full Length Newcastle disease virus Hemagglutinin-neuraminidase(HN) Protein (P12557) (1-571aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | NDV |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-571) |
Form : | Lyophilized powder |
AA Sequence : | MDRTVNQVALENDEREAKNTWRLVFRIATLLLIVMTLAFSAAALAYSMEASTPGDLVGIP TAISRAEEKITSALGSNQDVVDRIYKQVALESPLALLNTESIIMNAITSLSYQINGAANN SGCGAPVHDPDYIGGIGKELIVDDASDVTSFYPSAFQEHLNFIPAPTTGSGCTRIPSFDM SATHYCYTHNVILSGCRDHSQSHQYLALGVLRTSATGRVFFSTLRSINLDDTQNRKSCSV SATPLGCDMLCSKVTETEEEDYNSVTPTSMVHGRLGFDGQYHEKDLDVTTLFGDWVANYP GVGGGSFIDSRVWFPIYGGLKPNSPSDTAQEGRYVIYKRYNDTCPDEQDYQIRMAKSSYK PRRFGGKRVQQAILSIKVSTSLGEDPVLTVPPNTVTLMGAEGRVLTVGTSHFLYQRGSSY FSPALLYPMTVNNKTATLHSPYTFNAFTRPGSVPCQASARCPNSCVTGVYTDPYPLVFHA NHTLRGVFGTMLDDERARLNPVSAVFDNVSRSRITRVSSSSTKAAYTTSTCFKVVKTNKT YCLSIAEISNTLFGEFRIVPLLVEILKDDKV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | HN |
Synonyms | HN; Hemagglutinin-neuraminidase |
UniProt ID | P12557 |
◆ Recombinant Proteins | ||
OV16-1600O | Recombinant Onchocerca Volvulus OV16 Protein (17-197 aa), His-tagged | +Inquiry |
SE0228-3191S | Recombinant Staphylococcus epidermidis ATCC 12228 SE0228 protein, His-tagged | +Inquiry |
PGF-382R | Active Recombinant Rhesus macaque PGF protein, His-tagged | +Inquiry |
ACPP-1147H | Active Recombinant Human ACPP protein, His-tagged | +Inquiry |
SSPA-0759B | Recombinant Bacillus subtilis SSPA protein, His-tagged | +Inquiry |
◆ Native Proteins | ||
TcdA-188C | Active Native Clostridium difficile Toxin A Protein | +Inquiry |
APOB-216H | Native Human APOB Protein | +Inquiry |
C1S-550H | Active Native Human C1S Enzyme | +Inquiry |
MB-8227H | Native Human Heart Myoglobin | +Inquiry |
RO60-18C | Native Cattle RO60 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CYC1-7136HCL | Recombinant Human CYC1 293 Cell Lysate | +Inquiry |
CCL5-2706HCL | Recombinant Human CCL5 cell lysate | +Inquiry |
EMD-6612HCL | Recombinant Human EMD 293 Cell Lysate | +Inquiry |
ZNF79-8HCL | Recombinant Human ZNF79 293 Cell Lysate | +Inquiry |
LAT2-4815HCL | Recombinant Human LAT2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All HN Products
Required fields are marked with *
My Review for All HN Products
Required fields are marked with *
0
Inquiry Basket