Recombinant Full Length Human PAICS Protein, C-Flag-tagged
Cat.No. : | PAICS-1378HFL |
Product Overview : | Recombinant Full Length Human PAICS Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a bifunctional enzyme containing phosphoribosylaminoimidazole carboxylase activity in its N-terminal region and phosphoribosylaminoimidazole succinocarboxamide synthetase in its C-terminal region. It catalyzes steps 6 and 7 of purine biosynthesis. The gene is closely linked and divergently transcribed with a locus that encodes an enzyme in the same pathway, and transcription of the two genes is coordinately regulated. The human genome contains several pseudogenes of this gene. Multiple transcript variants encoding different isoforms have been found for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 46.9 kDa |
AA Sequence : | MATAEVLNIGKKLYEGKTKEVYELLDSPGKVLLQSKDQITAGNAARKNHLEGKAAISNKITSCIFQLLQE AGIKTAFTRKCGETAFIAPQCEMIPIEWVCRRIATGSFLKRNPGVKEGYKFYPPKVELFFKDDANNDPQW SEEQLIAAKFCFAGLLIGQTEVDIMSHATQAIFEILEKSWLPQNCTLVDMKIEFGVDVTTKEIVLADVID NDSWRLWPSGDRSQQKDKQSYRDLKEVTPEGLQMVKKNFEWVAERVELLLKSESQCRVVVLMGSTSDLGH CEKIKKACGNFGIPCELRVTSAHKGPDETLRIKAEYEGDGIPTVFVAVAGRSNGLGPVMSGNTAYPVISC PPLTPDWGVQDVWSSLRLPSGLGCSTVLSPEGSAQFAAQIFGLSNHLVWSKLRASILNTWISLKQADKKI RECNLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Metabolic pathways, Purine metabolism |
Full Length : | Full L. |
Gene Name | PAICS phosphoribosylaminoimidazole carboxylase and phosphoribosylaminoimidazolesuccinocarboxamide synthase [ Homo sapiens (human) ] |
Official Symbol | PAICS |
Synonyms | ADE2; AIRC; PAIS; ADE2H1; PAICSD |
Gene ID | 10606 |
mRNA Refseq | NM_001079524.2 |
Protein Refseq | NP_001072992.1 |
MIM | 172439 |
UniProt ID | P22234 |
◆ Recombinant Proteins | ||
PAICS-135H | Recombinant Human PAICS, His-tagged | +Inquiry |
PAICS-9942Z | Recombinant Zebrafish PAICS | +Inquiry |
PAICS-1378HFL | Recombinant Full Length Human PAICS Protein, C-Flag-tagged | +Inquiry |
PAICS-7072C | Recombinant Chicken PAICS | +Inquiry |
PAICS-4257R | Recombinant Rat PAICS Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
PAICS-3461HCL | Recombinant Human PAICS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All PAICS Products
Required fields are marked with *
My Review for All PAICS Products
Required fields are marked with *
0
Inquiry Basket