Recombinant Human NUDT21 Protein, GST-tagged

• Cat.No.: NUDT21-1816H
• Product Overview: Human CPSF5 full-length ORF ( AAH01403, 1 a.a. - 227 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: The protein encoded by this gene is one subunit of a cleavage factor required for 3' RNA cleavage and polyadenylation processing. The interaction of the protein with the RNA is one of the earliest steps in the assembly of the 3' end processing complex and facilitates the recruitment of other processing factors. This gene encodes the 25kD subunit of the protein complex, which is composed of four polypeptides. [provided by RefSeq, Jul 2008]
• Molecular Mass: 50.71 kDa
• AA Sequence: MSVVPPNRSQTGWPRGVTQFGNKYIQQTKPLTLERTINLYPLTNYTFGTKEPLYEKDSSVAARFQRMREEFDKIGMRRTVEGVLIVHEHRLPHVLLLQLGTTFFKLPGGELNPGEDEVEGLKRLMTEILGRQDGVLQDWVIDDCIGNWWRPNFEPPQYPYIPAHITKPKEHKKLFLVQLQEKALFAVPKNYKLVAAPLFELYDNAPGYGPIISSLPQLLSRFNFIYN
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NUDT21 nudix (nucleoside diphosphate linked moiety X)-type motif 21 [ Homo sapiens ]
• Official Symbol: NUDT21
• Synonyms: NUDT21; nudix (nucleoside diphosphate linked moiety X)-type motif 21; cleavage and polyadenylation specific factor 5, 25 kD subunit , cleavage and polyadenylation specific factor 5, 25 kDa , CPSF5; cleavage and polyadenylation specificity factor subunit 5; CFIM25; nudix motif 21; CPSF 25 kDa subunit; pre-mRNA cleavage factor Im (25kD); pre-mRNA cleavage factor Im, 25kD subunit; pre-mRNA cleavage factor Im 25 kDa subunit; nucleoside diphosphate-linked moiety X motif 21; cleavage and polyadenylation specific factor 5, 25 kDa; cleavage and polyadenylation specific factor 5, 25 kD subunit; cleavage and polyadenylation specificity factor 25 kDa subunit; CPSF5; DKFZp686H1588
• Gene ID: 11051
• mRNA Refseq: NM_007006
• Protein Refseq: NP_008937
• MIM: 604978
• UniProt ID: O43809