Recombinant Full Length Human NR5A2 Protein, GST-tagged
Cat.No. : | NR5A2-6747HF |
Product Overview : | Human NR5A2 full-length ORF ( NP_003813.1, 1 a.a. - 495 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 495 amino acids |
Description : | The protein encoded by this gene is a DNA-binding zinc finger transcription factor and is a member of the fushi tarazu factor-1 subfamily of orphan nuclear receptors. The encoded protein is involved in the expression of genes for hepatitis B virus and cholesterol biosynthesis, and may be an important regulator of embryonic development. [provided by RefSeq, Jun 2016] |
Molecular Mass : | 82.9 kDa |
AA Sequence : | MSSNSDTGDLQESLKHGLTPIVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKRA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NR5A2 nuclear receptor subfamily 5, group A, member 2 [ Homo sapiens ] |
Official Symbol | NR5A2 |
Synonyms | NR5A2; nuclear receptor subfamily 5, group A, member 2; FTF; nuclear receptor subfamily 5 group A member 2; B1F2; FTZ F1; FTZ F1beta; hB1F; hB1F 2; liver receptor homolog 1; LRH 1; nuclear receptor NR5A2; liver receptor homolog-1; CYP7A promoter-binding factor; hepatocytic transcription factor; alpha-1-fetoprotein transcription factor; liver nuclear receptor homolog-1 variant 2; fetoprotein-alpha 1 (AFP) transcription factor; b1-binding factor, hepatocyte transcription factor which activates enhancer II of hepatitis B virus; B1F; CPF; LRH1; LRH-1; FTZ-F1; hB1F-2; FTZ-F1beta; |
Gene ID | 2494 |
mRNA Refseq | NM_003822 |
Protein Refseq | NP_003813 |
MIM | 604453 |
UniProt ID | O00482 |
◆ Recombinant Proteins | ||
NR5A2-6635C | Recombinant Chicken NR5A2 | +Inquiry |
NR5A2-1092H | Recombinant Human NR5A2 protein, His-tagged | +Inquiry |
NR5A2-6747HF | Recombinant Full Length Human NR5A2 Protein, GST-tagged | +Inquiry |
NR5A2-4074R | Recombinant Rat NR5A2 Protein | +Inquiry |
NR5A2-9030Z | Recombinant Zebrafish NR5A2 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NR5A2 Products
Required fields are marked with *
My Review for All NR5A2 Products
Required fields are marked with *
0
Inquiry Basket