Recombinant Human NR5A2 Protein, GST-tagged

• Cat.No.: NR5A2-6100H
• Product Overview: Human NR5A2 full-length ORF ( NP_003813.1, 1 a.a. - 495 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The protein encoded by this gene is a DNA-binding zinc finger transcription factor and is a member of the fushi tarazu factor-1 subfamily of orphan nuclear receptors. The encoded protein is involved in the expression of genes for hepatitis B virus and cholesterol biosynthesis, and may be an important regulator of embryonic development. [provided by RefSeq, Jun 2016]
• Source: Wheat Germ
• Species: Human
• Tag: GST
• Molecular Mass: 82.9 kDa
• AA Sequence: MSSNSDTGDLQESLKHGLTPIVSQFKMVNYSYDEDLEELCPVCGDKVSGYHYGLLTCESCKGFFKRTVQNNKRYTCIENQNCQIDKTQRKRCPYCRFQKCLSVGMKLEAVRADRMRGGRNKFGPMYKRDRALKQQKKALIRANGLKLEAMSQVIQAMPSDLTISSAIQNIHSASKGLPLNHAALPPTDYDRSPFVTSPISMTMPPHGSLQGYQTYGHFPSRAIKSEYPDPYTSSPESIMGYSYMDSYQTSSPASIPHLILELLKCEPDEPQVQAKIMAYLQQEQANRSKHEKLSTFGLMCKMADQTLFSIVEWARSSIFFRELKVDDQMKLLQNCWSELLILDHIYRQVVHGKEGSIFLVTGQQVDYSIIASQAGATLNNLMSHAQELVAKLRSLQFDQREFVCLKFLVLFSLDVKNLENFQLVEGVQEQVNAALLDYTMCNYPQQTEKFGQLLLRLPEIRAISMQAEEYLYYKHLNGDVPYNNLLIEMLHAKRA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NR5A2 nuclear receptor subfamily 5, group A, member 2 [ Homo sapiens ]
• Official Symbol: NR5A2
• Synonyms: NR5A2; nuclear receptor subfamily 5, group A, member 2; FTF; nuclear receptor subfamily 5 group A member 2; B1F2; FTZ F1; FTZ F1beta; hB1F; hB1F 2; liver receptor homolog 1; LRH 1; nuclear receptor NR5A2; liver receptor homolog-1; CYP7A promoter-binding factor; hepatocytic transcription factor; alpha-1-fetoprotein transcription factor; liver nuclear receptor homolog-1 variant 2; fetoprotein-alpha 1 (AFP) transcription factor; b1-binding factor, hepatocyte transcription factor which activates enhancer II of hepatitis B virus; B1F; CPF; LRH1; LRH-1; FTZ-F1; hB1F-2; FTZ-F1beta
• Gene ID: 2494
• mRNA Refseq: NM_003822
• Protein Refseq: NP_003813
• MIM: 604453
• UniProt ID: O00482