Recombinant Full Length Human NLGN4Y Protein, GST-tagged
Cat.No. : | NLGN4Y-6715HF |
Product Overview : | Human NLGN4Y full-length ORF ( AAH32567, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 134 amino acids |
Description : | Neuroligins, such as NLGN4Y, are cell adhesion molecules present at the postsynaptic side of the synapse and may be essential for the formation of functional synapses (Jamain et al., 2003 [PubMed 12669065]).[supplied by OMIM |
Molecular Mass : | 40.48 kDa |
AA Sequence : | MLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDGTNIKRNADDITSNDHGEDKDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGMQEARLCGSSKMFNYFKSPFTNLINFF |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | NLGN4Y neuroligin 4, Y-linked [ Homo sapiens ] |
Official Symbol | NLGN4Y |
Synonyms | NLGN4Y; neuroligin 4, Y-linked; neuroligin 4, Y linked; neuroligin-4, Y-linked; KIAA0951; |
Gene ID | 22829 |
mRNA Refseq | NM_001164238 |
Protein Refseq | NP_001157710 |
MIM | 400028 |
UniProt ID | Q8NFZ3 |
◆ Recombinant Proteins | ||
NLGN4Y-01H | Recombinant Human NLGN4Y Protein(Q8NFZ3-1, Gln44-Leu675), His-tagged | +Inquiry |
NLGN4Y-02H | Recombinant Human NLGN4Y Protein(Gln44-Leu675), His-tagged | +Inquiry |
NLGN4Y-2492H | Recombinant Human NLGN4Y Protein, His-tagged | +Inquiry |
NLGN4Y-6715HF | Recombinant Full Length Human NLGN4Y Protein, GST-tagged | +Inquiry |
NLGN4Y-5228H | Recombinant Human NLGN4Y, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
NLGN4Y-3807HCL | Recombinant Human NLGN4Y 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All NLGN4Y Products
Required fields are marked with *
My Review for All NLGN4Y Products
Required fields are marked with *
0
Inquiry Basket