Recombinant Full Length Human NLGN4Y Protein, GST-tagged

• Cat.No.: NLGN4Y-6715HF
• Product Overview: Human NLGN4Y full-length ORF ( AAH32567, 1 a.a. - 134 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 134 amino acids
• Description: Neuroligins, such as NLGN4Y, are cell adhesion molecules present at the postsynaptic side of the synapse and may be essential for the formation of functional synapses (Jamain et al., 2003 [PubMed 12669065]).[supplied by OMIM
• Molecular Mass: 40.48 kDa
• AA Sequence: MLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDGTNIKRNADDITSNDHGEDKDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGMQEARLCGSSKMFNYFKSPFTNLINFF
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: NLGN4Y neuroligin 4, Y-linked [ Homo sapiens ]
• Official Symbol: NLGN4Y
• Synonyms: NLGN4Y; neuroligin 4, Y-linked; neuroligin 4, Y linked; neuroligin-4, Y-linked; KIAA0951
• Gene ID: 22829
• mRNA Refseq: NM_001164238
• Protein Refseq: NP_001157710
• MIM: 400028
• UniProt ID: Q8NFZ3