Recombinant Human NLGN4Y Protein(Gln44-Leu675), His-tagged
Cat.No. : | NLGN4Y-02H |
Product Overview : | Recombinant human NLGN4Y protein(Gln44-Leu675) with a His-tag was expressed in HEK293 |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | His |
ProteinLength : | 44-675 a.a. |
Description : | This gene encodes a type I membrane protein that belongs to the family of neuroligins, which are cell adhesion molecules present at the postsynaptic side of the synapse, and may be essential for the formation of functional synapses. Alternatively spliced transcript variants have been found for this gene. |
Molecular Mass : | The protein has a calculated MW of 72 kDa. |
AA Sequence : | QYPVVNTNYGKIQGLRTPLPSEILGPVEQYLGVPYASPPTGERRFQPPESPSSWTGIRNATQFSAVCPQHLDERFLLHDMLPIWFTTSLDTLMTYVQDQNEDCLYLNIYVPMEDDIHEQNSKKPVMVYIHGGSYMEGTGNMIDGSILASYGNVIVITINYRLGILGFLSTGDQAAKGNYGLLDQIQALRWIEENVGAFGGDPKRVTIFGSGAGASCVSLLTLSHYSEGLFQKAIIQSGTALSSWAVNYQPAKYTRILADKVGCNMLDTTDMVECLKNKNYKELIQQTITPATYHIAFGPVIDGDVIPDDPQILMEQGEFLNYDIMLGVNQGEGLKFVDGIVDNEDGVTPNDFDFSVSNFVDNLYGYPEGKDTLRETIKFMYTDWADKENPETRRKTLVALFTDHQWVAPAVATADLHAQYGSPTYFYAFYHHCQSEMKPSWADSAHGDEVPYVFGIPMIGPTELFSCNFSKNDVMLSAVVMTYWTNFAKTGDPNQPVPQDTKFIHTKPNRFEEVAWSKYNPKDQLYLHIGLKPRVRDHYRATKVAFWLELVPHLHNLNEIFQYVSTTTKVPPPDMTSFPYGTRRSPAKIWPTTKRPAITPANNPKHSKDPHKTGPEDTTVLIETKRDYSTELGGGSGGGSHHHHHHHHHH |
Endotoxin : | <1 EU/μg |
Purity : | >90% by SDS-PAGE |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Concentration : | 0.22 mg/mL |
Storage Buffer : | PBS, pH7.4 |
Gene Name | NLGN4Y neuroligin 4, Y-linked [ Homo sapiens (human) ] |
Official Symbol | NLGN4Y |
Synonyms | NLGN4Y; neuroligin 4, Y-linked; neuroligin 4, Y linked; neuroligin-4, Y-linked; KIAA0951; |
Gene ID | 22829 |
mRNA Refseq | NM_001164238 |
Protein Refseq | NP_001157710 |
MIM | 400028 |
UniProt ID | Q8NFZ3 |
◆ Recombinant Proteins | ||
SYCE1-3074H | Recombinant Human SYCE1 Protein, MYC/DDK-tagged | +Inquiry |
RFL5222HF | Recombinant Full Length Helicobacter Pylori Atp Synthase Subunit A(Atpb) Protein, His-Tagged | +Inquiry |
Pgrmc1-4829M | Recombinant Mouse Pgrmc1 Protein, Myc/DDK-tagged | +Inquiry |
Gypc-1834M | Recombinant Mouse Gypc protein, His & GST-tagged | +Inquiry |
DESI1B-10550Z | Recombinant Zebrafish DESI1B | +Inquiry |
◆ Native Proteins | ||
AGE-39 | Active Native Human Advanced Glycation End Product (AGE) Protein | +Inquiry |
F11-2466H | Native Human Coagulation Factor XI | +Inquiry |
Collagen-121B | Native Bovine Type II Collagen, FITC-tagged | +Inquiry |
AZU1-40H | Native Human Azurocidin | +Inquiry |
IgM-331S | Native Sheep IgM | +Inquiry |
◆ Cell & Tissue Lysates | ||
FZR1-6087HCL | Recombinant Human FZR1 293 Cell Lysate | +Inquiry |
UQCC1-491HCL | Recombinant Human UQCC 293 Cell Lysate | +Inquiry |
SYNGR3-1317HCL | Recombinant Human SYNGR3 293 Cell Lysate | +Inquiry |
PRDM10-2886HCL | Recombinant Human PRDM10 293 Cell Lysate | +Inquiry |
RHOJ-2348HCL | Recombinant Human RHOJ 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All NLGN4Y Products
Required fields are marked with *
My Review for All NLGN4Y Products
Required fields are marked with *
0
Inquiry Basket