Recombinant Full Length Human NAT2 Protein, N-His-tagged

• Cat.No.: NAT2-35HFL
• Product Overview: Recombinant Full Length Human NAT2 Protein, fused to His-tag at N-terminus, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Description: This gene encodes an enzyme that functions to both activate and deactivate arylamine and hydrazine drugs and carcinogens. Polymorphisms in this gene are responsible for the N-acetylation polymorphism in which human populations segregate into rapid, intermediate, and slow acetylator phenotypes. Polymorphisms in this gene are also associated with higher incidences of cancer and drug toxicity. A second polymorphic arylamine N-acetyltransferase gene (NAT1), is located near this gene (NAT2).
• Form: 50 mM Tris-HCl, pH 8.0, 8 M urea.
• Molecular Mass: 33.4 kDa
• AA Sequence: MDIEAYFERIGYKNSRNKLDLETLTDILEHQIRAVPFENLNMHCGQAMELGLEAIFDHIVRRNRGGWCLQVNQLLYWALTTIGFQTTMLGGYFYIPPVNKYSTGMVHLLLQVTIDGRNYIVDAGSGSSSQMWQPLELISGKDQPQVPCIFCLTEERGIWYLDQIRREQYITNKEFLNSHLLPKKKHQKIYLFTLEPRTIEDFESMNTYLQTSPTSSFITTSFCSLQTPEGVYCLVGFILTYRKFNYKDNTDLVEFKTLTEEEVEEVLRNIFKISLGRNLVPKPGDGSLTI
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Notes: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Protein Families: Transmembrane
• Protein Pathways: Caffeine metabolism, Drug metabolism - other enzymes, Metabolic pathways
• Full Length: Full L.

Gene Information

• Gene Name: NAT2 N-acetyltransferase 2 [ Homo sapiens (human) ]
• Official Symbol: NAT2
• Synonyms: AAC2; PNAT; NAT-2
• Gene ID: 10
• mRNA Refseq: NM_000015.3
• Protein Refseq: NP_000006.2
• MIM: 612182
• UniProt ID: P11245