Recombinant Full Length Human MYO1H Protein, GST-tagged

• Cat.No.: MYO1H-5054HF
• Product Overview: Human FLJ37587 full-length ORF ( ENSP00000308083, 1 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 127 amino acids
• Description: MYO1H (Myosin IH) is a Protein Coding gene. Diseases associated with MYO1H include Spastic Paraplegia 36, Autosomal Dominant. Among its related pathways are Delta508-CFTR traffic / ER-to-Golgi in CF. GO annotations related to this gene include actin binding and motor activity. An important paralog of this gene is MYO1C.
• Molecular Mass: 41.2 kDa
• AA Sequence: MCVRNLVQKYCRGITAERKAMMQQKVVTSEIFRGRKDGYTESLNQPFVNSRIDEGDINPKVLQLISHEKIQYGVPVIKYDRKGFKARQRQLILTQKAAYVVELAKIKQKIEYSALKGKKWAIFKTMH
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYO1H myosin IH [ Homo sapiens (human) ]
• Official Symbol: MYO1H
• Synonyms: MYO1H; myosin IH; unconventional myosin-Ih; myosin-1H; myosin-Ih
• Gene ID: 283446
• mRNA Refseq: NM_001101421
• Protein Refseq: NP_001094891
• MIM: 614636
• UniProt ID: Q8N1T3