Recombinant Full Length Human MYO1H Protein, GST-tagged

Cat.No. : MYO1H-5054HF
Product Overview : Human FLJ37587 full-length ORF ( ENSP00000308083, 1 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 127 amino acids
Description : MYO1H (Myosin IH) is a Protein Coding gene. Diseases associated with MYO1H include Spastic Paraplegia 36, Autosomal Dominant. Among its related pathways are Delta508-CFTR traffic / ER-to-Golgi in CF. GO annotations related to this gene include actin binding and motor activity. An important paralog of this gene is MYO1C.
Molecular Mass : 41.2 kDa
AA Sequence : MCVRNLVQKYCRGITAERKAMMQQKVVTSEIFRGRKDGYTESLNQPFVNSRIDEGDINPKVLQLISHEKIQYGVPVIKYDRKGFKARQRQLILTQKAAYVVELAKIKQKIEYSALKGKKWAIFKTMH
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name MYO1H myosin IH [ Homo sapiens (human) ]
Official Symbol MYO1H
Synonyms MYO1H; myosin IH; unconventional myosin-Ih; myosin-1H; myosin-Ih
Gene ID 283446
mRNA Refseq NM_001101421
Protein Refseq NP_001094891
MIM 614636
UniProt ID Q8N1T3

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MYO1H Products

Required fields are marked with *

My Review for All MYO1H Products

Required fields are marked with *

0

Inquiry Basket

cartIcon