Recombinant Human MYO1H Protein, GST-tagged
Cat.No. : | MYO1H-4325H |
Product Overview : | Human FLJ37587 full-length ORF ( ENSP00000308083, 1 a.a. - 127 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | MYO1H (Myosin IH) is a Protein Coding gene. Diseases associated with MYO1H include Spastic Paraplegia 36, Autosomal Dominant. Among its related pathways are Delta508-CFTR traffic / ER-to-Golgi in CF. GO annotations related to this gene include actin binding and motor activity. An important paralog of this gene is MYO1C. |
Molecular Mass : | 41.2 kDa |
AA Sequence : | MCVRNLVQKYCRGITAERKAMMQQKVVTSEIFRGRKDGYTESLNQPFVNSRIDEGDINPKVLQLISHEKIQYGVPVIKYDRKGFKARQRQLILTQKAAYVVELAKIKQKIEYSALKGKKWAIFKTMH |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | MYO1H myosin IH [ Homo sapiens (human) ] |
Official Symbol | MYO1H |
Synonyms | MYO1H; myosin IH; unconventional myosin-Ih; myosin-1H; myosin-Ih |
Gene ID | 283446 |
mRNA Refseq | NM_001101421 |
Protein Refseq | NP_001094891 |
MIM | 614636 |
UniProt ID | Q8N1T3 |
◆ Recombinant Proteins | ||
MYO1H-4325H | Recombinant Human MYO1H Protein, GST-tagged | +Inquiry |
MYO1H-3561H | Recombinant Human MYO1H Protein, His (Fc)-Avi-tagged | +Inquiry |
MYO1H-1244H | Recombinant Human MYO1H | +Inquiry |
MYO1H-5054HF | Recombinant Full Length Human MYO1H Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYO1H Products
Required fields are marked with *
My Review for All MYO1H Products
Required fields are marked with *
0
Inquiry Basket