Recombinant Full Length Human MYL12B Protein, GST-tagged

• Cat.No.: MYL12B-6369HF
• Product Overview: Human MRLC2 full-length ORF ( NP_291024.1, 1 a.a. - 172 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: The activity of nonmuscle myosin II (see MYH9; MIM 160775) is regulated by phosphorylation of a regulatory light chain, such as MRLC2. This phosphorylation results in higher MgATPase activity and the assembly of myosin II filaments (Iwasaki et al., 2001 [PubMed 11942626]).[supplied by OMIM
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 46.2 kDa
• Protein length: 172 amino acids
• AA Sequence: MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MYL12B myosin light chain 12B [ Homo sapiens (human) ]
• Official Symbol: MYL12B
• Synonyms: MYL12B; myosin light chain 12B; MLC-B; MRLC2; myosin regulatory light chain 12B; MLC-2; MLC-2A; MLC20; SHUJUN-1; myosin regulatory light chain 2; myosin regulatory light chain 2-B, smooth muscle isoform; myosin regulatory light chain 20 kDa; myosin regulatory light chain MRLC2; myosin, light chain 12B, regulatory
• Gene ID: 103910
• mRNA Refseq: NM_001144944
• Protein Refseq: NP_001138416
• MIM: 609211
• UniProt ID: O14950