Recombinant Human MYL12B protein, His-GST-tagged
Cat.No. : | MYL12B-5763H |
Product Overview : | Recombinant Human MYL12B protein(O14950)(1-172aa), fused with N-terminal His and GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | GST&His |
Protein Length : | 1-172aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 51.3 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD |
Gene Name | MYL12B myosin, light chain 12B, regulatory [ Homo sapiens ] |
Official Symbol | MYL12B |
Synonyms | MYL12B; myosin, light chain 12B, regulatory; myosin regulatory light chain 12B; MRLC2; myosin regulatory light chain 2; MLC-2; MLC20; MLC-2A; SHUJUN-1; myosin regulatory light chain MRLC2; myosin regulatory light chain 20 kDa; myosin regulatory light chain 2-B, smooth muscle isoform; MLC-B; |
Gene ID | 103910 |
mRNA Refseq | NM_001144944 |
Protein Refseq | NP_001138416 |
MIM | 609211 |
UniProt ID | O14950 |
◆ Recombinant Proteins | ||
MYL12B-682H | Active Recombinant Human Myosin, Light Chain 12B, Regulatory | +Inquiry |
Myl12b-4249M | Recombinant Mouse Myl12b Protein, Myc/DDK-tagged | +Inquiry |
MYL12B-5763H | Recombinant Human MYL12B protein, His-GST-tagged | +Inquiry |
MYL12B-1263H | Recombinant Human MYL12B Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MYL12B-10313M | Recombinant Mouse MYL12B Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYL12B-4029HCL | Recombinant Human MYL12B 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYL12B Products
Required fields are marked with *
My Review for All MYL12B Products
Required fields are marked with *
0
Inquiry Basket