Recombinant Human MYL12B protein, His-GST-tagged

• Cat.No.: MYL12B-5763H
• Product Overview: Recombinant Human MYL12B protein(O14950)(1-172aa), fused with N-terminal His and GST tag, was expressed in E.coli.

Specification

• Source: E.coli
• Species: Human
• Tag: N-His-GST
• Protein length: 1-172aa
• Form: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Molecular Mass: 51.3 kDa
• AASequence: MSSKKAKTKTTKKRPQRATSNVFAMFDQSQIQEFKEAFNMIDQNRDGFIDKEDLHDMLASLGKNPTDAYLDAMMNEAPGPINFTMFLTMFGEKLNGTDPEDVIRNAFACFDEEATGTIQEDYLRELLTTMGDRFTDEEVDELYREAPIDKKGNFNYIEFTRILKHGAKDKDD
• Purity: Greater than 85% as determined by SDS-PAGE.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C.

Gene Information

• Gene Name: MYL12B myosin, light chain 12B, regulatory [ Homo sapiens ]
• Official Symbol: MYL12B
• Synonyms: MYL12B; myosin, light chain 12B, regulatory; myosin regulatory light chain 12B; MRLC2; myosin regulatory light chain 2; MLC-2; MLC20; MLC-2A; SHUJUN-1; myosin regulatory light chain MRLC2; myosin regulatory light chain 20 kDa; myosin regulatory light chain 2-B, smooth muscle isoform; MLC-B
• Gene ID: 103910
• mRNA Refseq: NM_001144944
• Protein Refseq: NP_001138416
• MIM: 609211
• UniProt ID: O14950