Recombinant Full Length Human MYD88 Protein, C-Flag-tagged
Cat.No. : | MYD88-687HFL |
Product Overview : | Recombinant Full Length Human MYD88 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways regulate that activation of numerous proinflammatory genes. The encoded protein consists of an N-terminal death domain and a C-terminal Toll-interleukin1 receptor domain. Patients with defects in this gene have an increased susceptibility to pyogenic bacterial infections. Alternate splicing results in multiple transcript variants. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 33.1 kDa |
AA Sequence : | MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADP TGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPR TAELAGITTLDDPLGHMPERFDAFICYCPSDIQFVQEMIRQLEQTNYRLKLCVSDRDVLPGTCVWSIASE LIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKRLIPIKYKAMKKEFPSILRFITVCDYTNPC TKSWFWTRLAKALSLPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Protein Pathways : | Apoptosis, Toll-like receptor signaling pathway |
Full Length : | Full L. |
Gene Name | MYD88 MYD88 innate immune signal transduction adaptor [ Homo sapiens (human) ] |
Official Symbol | MYD88 |
Synonyms | IMD68; MYD88D |
Gene ID | 4615 |
mRNA Refseq | NM_002468.5 |
Protein Refseq | NP_002459.3 |
MIM | 602170 |
UniProt ID | Q99836 |
◆ Recombinant Proteins | ||
MYD88-301136H | Recombinant Human MYD88 protein, GST-tagged | +Inquiry |
MYD88-272H | Recombinant Human MYD88 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
MYD88-687HFL | Recombinant Full Length Human MYD88 Protein, C-Flag-tagged | +Inquiry |
MYD88-5796H | Recombinant Human MYD88 Protein, GST-tagged | +Inquiry |
MYD88-3502R | Recombinant Rat MYD88 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYD88-4034HCL | Recombinant Human MYD88 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYD88 Products
Required fields are marked with *
My Review for All MYD88 Products
Required fields are marked with *
0
Inquiry Basket