Recombinant Human MYD88 protein, His-tagged
Cat.No. : | MYD88-301138H |
Product Overview : | Recombinant Human MYD88 protein(1-150 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-150 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MAAGGPGAGSAAPVSSTSSLPLAALNMRVRRRLSLFLNVRTQVAADWTALAEEMDFEYLEIRQLETQADPTGRLLDAWQGRPGASVGRLLELLTKLGRDDVLLELGPSIEEDCQKYILKQQQEEAEKPLQVAAVDSSVPRTAELAGITTL |
Gene Name | MYD88 myeloid differentiation primary response gene (88) [ Homo sapiens ] |
Official Symbol | MYD88 |
Synonyms | MYD88; myeloid differentiation primary response gene (88); myeloid differentiation primary response protein MyD88; MYD88D; |
Gene ID | 4615 |
mRNA Refseq | NM_001172566 |
Protein Refseq | NP_001166037 |
MIM | 602170 |
UniProt ID | Q99836 |
◆ Recombinant Proteins | ||
MYD88-12080Z | Recombinant Zebrafish MYD88 | +Inquiry |
MYD88-1462H | Recombinant Human MYD88 Protein, His (Fc)-Avi-tagged | +Inquiry |
MYD88-301138H | Recombinant Human MYD88 protein, His-tagged | +Inquiry |
Myd88-4241M | Recombinant Mouse Myd88 Protein, Myc/DDK-tagged | +Inquiry |
MYD88-272H | Recombinant Human MYD88 Protein, MYC/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
MYD88-4034HCL | Recombinant Human MYD88 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MYD88 Products
Required fields are marked with *
My Review for All MYD88 Products
Required fields are marked with *
0
Inquiry Basket