Recombinant Full Length Human MVP Protein, C-Flag-tagged
Cat.No. : | MVP-1081HFL |
Product Overview : | Recombinant Full Length Human MVP Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes the major component of the vault complex. Vaults are multi-subunit ribonucleoprotein structures that may be involved in nucleo-cytoplasmic transport. The encoded protein may play a role in multiple cellular processes by regulating the MAP kinase, JAK/STAT and phosphoinositide 3-kinase/Akt signaling pathways. The encoded protein also plays a role in multidrug resistance, and expression of this gene may be a prognostic marker for several types of cancer. Alternatively spliced transcript variants have been observed for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 99.1 kDa |
AA Sequence : | MATEEFIIRIPPYHYIHVLDQNSNVSRVEVGPKTYIRQDNERVLFAPMRMVTVPPRHYCTVANPVSRDAQ GLVLFDVTGQVRLRHADLEIRLAQDPFPLYPGEVLEKDITPLQVVLPNTALHLKALLDFEDKDGDKVVAG DEWLFEGPGTYIPRKEVEVVEIIQATIIRQNQALRLRARKECWDRDGKERVTGEEWLVTTVGAYLPAVFE EVLDLVDAVILTEKTALHLRARRNFRDFRGVSRRTGEEWLVTVQDTEAHVPDVHEEVLGVVPITTLGPHN YCVILDPVGPDGKNQLGQKRVVKGEKSFFLQPGEQLEQGIQDVYVLSEQQGLLLRALQPLEEGEDEEKVS HQAGDHWLIRGPLEYVPSAKVEVVEERQAIPLDENEGIYVQDVKTGKVRAVIGSTYMLTQDEVLWEKELP PGVEELLNKGQDPLADRGEKDTAKSLQPLAPRNKTRVVSYRVPHNAAVQVYDYREKRARVVFGPELVSLG PEEQFTVLSLSAGRPKRPHARRALCLLLGPDFFTDVITIETADHARLQLQLAYNWHFEVNDRKDPQETAK LFSVPDFVGDACKAIASRVRGAVASVTFDDFHKNSARIIRTAVFGFETSEAKGPDGMALPRPRDQAVFPQ NGLVVSSVDVQSVEPVDQRTRDALQRSVQLAIEITTNSQEAAAKHEAQRLEQEARGRLERQKILDQSEAE KARKELLELEALSMAVESTGTAKAEAESRAEAARIEGEGSVLQAKLKAQALAIETEAELQRVQKVRELEL VYARAQLELEVSKAQQLAEVEVKKFKQMTEAIGPSTIRDLAVAGPEMQVKLLQSLGLKSTLITDGSTPIN LFNTAFGLLGMGPEGQPLGRRVASGPSPGEGISPQSAQAPQAPGDNHVVPVLRTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome |
Full Length : | Full L. |
Gene Name | MVP major vault protein [ Homo sapiens (human) ] |
Official Symbol | MVP |
Synonyms | LRP; VAULT1 |
Gene ID | 9961 |
mRNA Refseq | NM_005115.5 |
Protein Refseq | NP_005106.2 |
MIM | 605088 |
UniProt ID | Q14764 |
◆ Recombinant Proteins | ||
LMX1A-3120Z | Recombinant Zebrafish LMX1A | +Inquiry |
Snap29-5993M | Recombinant Mouse Snap29 Protein, Myc/DDK-tagged | +Inquiry |
CMTM7-757R | Recombinant Rhesus Macaque CMTM7 Protein, His (Fc)-Avi-tagged | +Inquiry |
Fcgr1-838M | Active Recombinant Mouse Fcgr1 Protein, His & Avi-tagged | +Inquiry |
DYRK3-5436HF | Active Recombinant Full Length Human DYRK3 Protein, GST-tagged | +Inquiry |
◆ Native Proteins | ||
MMP2-8455M | Native Mouse MMP2 | +Inquiry |
LDL-404H | Native Human Low Density Lipoprotein, Oxidized, Biotin labeled | +Inquiry |
FGG -57R | Native Rabbit Fibrinogen, FITC Labeled | +Inquiry |
MMP9-39H | Native Human MMP-9/Lipocalin Complex | +Inquiry |
H1N12099-209I | Native H1N1 (A/New Caledonia/20/99) H1N12099 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
KCTD14-5008HCL | Recombinant Human KCTD14 293 Cell Lysate | +Inquiry |
PKIA-3158HCL | Recombinant Human PKIA 293 Cell Lysate | +Inquiry |
HA-1668HCL | Recombinant H4N4 HA cell lysate | +Inquiry |
HIP1-788HCL | Recombinant Human HIP1 cell lysate | +Inquiry |
ASB3-8664HCL | Recombinant Human ASB3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MVP Products
Required fields are marked with *
My Review for All MVP Products
Required fields are marked with *
0
Inquiry Basket