Recombinant Full Length Human MSRB3 Protein, GST-tagged

• Cat.No.: MSRB3-6470HF
• Product Overview: Human MSRB3 full-length ORF ( NP_001026849.1, 1 a.a. - 185 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 185 amino acids
• Description: The protein encoded by this gene catalyzes the reduction of methionine sulfoxide to methionine. This enzyme acts as a monomer and requires zinc as a cofactor. Several transcript variants encoding two different isoforms have been found for this gene. One of the isoforms localizes to mitochondria while the other localizes to endoplasmic reticula. [provided by RefSeq, Jul 2010]
• Molecular Mass: 46.4 kDa
• AA Sequence: MSAFNLLHLVTKSQPVALRACGLPSGSCRDKKNCKVVFSQQELRKRLTPLQYHVTQEKGTESAFEGEYTHHKDPGIYKCVVCGTPLFKSETKFDSGSGWPSFHDVINSEAITFTDDFSYGMHRVETSCSQCGAHLGHIFDDGPRPTGKRYCINSAALSFTPADSSGTAEGGSGVASPAQADKAEL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: MSRB3 methionine sulfoxide reductase B3 [ Homo sapiens ]
• Official Symbol: MSRB3
• Synonyms: MSRB3; methionine sulfoxide reductase B3; deafness, autosomal recessive 74 , DFNB74; methionine-R-sulfoxide reductase B3; DKFZp686C1178; FLJ36866; methionine-R-sulfoxide reductase B3, mitochondrial; DFNB74
• Gene ID: 253827
• mRNA Refseq: NM_001031679
• Protein Refseq: NP_001026849
• MIM: 613719
• UniProt ID: Q8IXL7