Recombinant Full Length Human MSI1 Protein

• Cat.No.: MSI1-317HF
• Product Overview: Recombinant full length Human Musashi 1 / Msi1 with a proprietary tag; Predicted MWt 65.89 kDa including tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 362 amino acids
• Description: This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.
• Form: Liquid
• Molecular Mass: 65.890kDa inclusive of tags
• AA Sequence: METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNGYH
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: MSI1 musashi homolog 1 (Drosophila) [ Homo sapiens ]
• Official Symbol: MSI1
• Synonyms: MSI1; musashi homolog 1 (Drosophila); Musashi (Drosophila) homolog 1; RNA-binding protein Musashi homolog 1
• Gene ID: 4440
• mRNA Refseq: NM_002442
• Protein Refseq: NP_002433
• MIM: 603328
• UniProt ID: O43347