Recombinant Human MSI1

Cat.No. : MSI1-30259TH
Product Overview : Recombinant full length Human Musashi 1 / Msi1 with a proprietary tag; Predicted MWt 65.89 kDa including tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 362 amino acids
Description : This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Expression of this gene has been correlated with the grade of the malignancy and proliferative activity in gliomas and melanomas. A pseudogene for this gene is located on chromosome 11q13.
Molecular Weight : 65.890kDa inclusive of tags
Tissue specificity : Detected in fetal kidney, brain, liver and lung, and in adult brain and pancreas. Detected in hepatoma cell lines.
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.31% Glutathione, 0.79% Tris HCl
Storage : Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : METDAPQPGLASPDSPHDPCKMFIGGLSWQTTQEGLREYFGQFGEVKECLVMRDPLTKRSRGFGFVTFMDQAGVDKVLAQSRHELDSKTIDPKVAFPRRAQPKMVTRTKKIFVGGLSVNTTVEDVKQYFEQFGKVDDAMLMFDKTTNRHRGFGFVTFESEDIVEKVCEIHFHEINNKMVECKKAQPKEVMSPTGSARGRSRVMPYGMDAFMLGIGMLGYPGFQATTYASRSYTGLAPGYTYQFPEFRVERTPLPSAPVLPELTAIPLTAYGPMAAAAAAAAVVRGTGSHPWTMAPPPGSTPSRTGGFLGTTSPGPMAELYGAANQDSGVSSYISAASPAPSTGFGHSLGGPLIATAFTNGYH
Sequence Similarities : Belongs to the Musashi family.Contains 2 RRM (RNA recognition motif) domains.
Gene Name MSI1 musashi homolog 1 (Drosophila) [ Homo sapiens ]
Official Symbol MSI1
Synonyms MSI1; musashi homolog 1 (Drosophila); Musashi (Drosophila) homolog 1; RNA-binding protein Musashi homolog 1;
Gene ID 4440
mRNA Refseq NM_002442
Protein Refseq NP_002433
MIM 603328
Uniprot ID O43347
Chromosome Location 12q24
Pathway mRNA surveillance pathway, organism-specific biosystem; mRNA surveillance pathway, conserved biosystem;
Function RNA binding; nucleotide binding; poly(U) RNA binding; single-stranded RNA binding;

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All MSI1 Products

Required fields are marked with *

My Review for All MSI1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon