Recombinant Full Length Human Melanopsin(Opn4) Protein, His-Tagged
Cat.No. : | RFL7046HF |
Product Overview : | Recombinant Full Length Human Melanopsin(OPN4) Protein (Q9UHM6) (1-478aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-478) |
Form : | Lyophilized powder |
AA Sequence : | MNPPSGPRVPPSPTQEPSCMATPAPPSWWDSSQSSISSLGRLPSISPTAPGTWAAAWVPL PTVDVPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRSRSLRTPANMFIINLAVSDFLMS FTQAPVFFTSSLYKQWLFGETGCEFYAFCGALFGISSMITLTAIALDRYLVITRPLATFG VASKRRAAFVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMSFTPAVRAYTMLLC CFVFFLPLLIIIYCYIFIFRAIRETGRALQTFGACKGNGESLWQRQRLQSECKMAKIMLL VILLFVLSWAPYSAVALVAFAGYAHVLTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVA IAQHLPCLGVLLGVSRRHSRPYPSYRSTHRSTLTSHTSNLSWISIRRRQESLGSESEVGW THMEAAAVWGAAQQANGRSLYGQGLEDLEAKAPPRPQGHEAETPGKTKGLIPSQDPRM |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | OPN4 |
Synonyms | OPN4; MOP; Melanopsin; Opsin-4 |
UniProt ID | Q9UHM6 |
◆ Recombinant Proteins | ||
EIF6-2911H | Recombinant Human Eukaryotic Translation Initiation Factor 6, T7-tagged | +Inquiry |
VARS2-6501R | Recombinant Rat VARS2 Protein | +Inquiry |
CRYGS3-2044Z | Recombinant Zebrafish CRYGS3 | +Inquiry |
RFL18299HF | Recombinant Full Length Human Transmembrane Protein 64(Tmem64) Protein, His-Tagged | +Inquiry |
IL36G-511H | Recombinant Human IL36G protein | +Inquiry |
◆ Native Proteins | ||
BPE-138 | Native Red algae B-Phycoerythrin protein | +Inquiry |
PLAU -15H | Native Human HMW urokinase, HRP conjugate | +Inquiry |
CPD A-036H | Active Native Human Pancreatic Carboxypeptidase A | +Inquiry |
ITGA2B-10H | Native Human GPIIbIIIa | +Inquiry |
CRP-4303H | Native Human C-reactive Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
TMED7-671HCL | Recombinant Human TMED7 lysate | +Inquiry |
TMEM231-960HCL | Recombinant Human TMEM231 293 Cell Lysate | +Inquiry |
Skin-113M | Mouse Skin Tissue Lysate | +Inquiry |
PPP1CA-2951HCL | Recombinant Human PPP1CA 293 Cell Lysate | +Inquiry |
OR10A5-3569HCL | Recombinant Human OR10A5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All OPN4 Products
Required fields are marked with *
My Review for All OPN4 Products
Required fields are marked with *
0
Inquiry Basket