Recombinant Full Length Mouse Melanopsin(Opn4) Protein, His-Tagged
Cat.No. : | RFL471MF |
Product Overview : | Recombinant Full Length Mouse Melanopsin(Opn4) Protein (Q9QXZ9) (1-521aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Mus musculus |
Source : | E.coli |
Tag : | His |
ProteinLength : | Full Length (1-521) |
Form : | Lyophilized powder |
AA Sequence : | MDSPSGPRVLSSLTQDPSFTTSPALQGIWNGTQNVSVRAQLLSVSPTTSAHQAAAWVPFP TVDVPDHAHYTLGTVILLVGLTGMLGNLTVIYTFCRNRGLRTPANMFIINLAVSDFLMSV TQAPVFFASSLYKKWLFGETGCEFYAFCGAVFGITSMITLTAIAMDRYLVITRPLATIGR GSKRRTALVLLGVWLYALAWSLPPFFGWSAYVPEGLLTSCSWDYMTFTPQVRAYTMLLFC FVFFLPLLIIIFCYIFIFRAIRETGRACEGCGESPLRQRRQWQRLQSEWKMAKVALIVIL LFVLSWAPYSTVALVAFAGYSHILTPYMSSVPAVIAKASAIHNPIIYAITHPKYRVAIAQ HLPCLGVLLGVSGQRSHPSLSYRSTHRSTLSSQSSDLSWISGRKRQESLGSESEVGWTDT ETTAAWGAAQQASGQSFCSQNLEDGELKASSSPQVQRSKTPKVPGPSTCRPMKGQGARPS SLRGDQKGRLAVCTGLSECPHPHTSQFPLAFLEDDVTLRHL |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | Opn4 |
Synonyms | Opn4; Mop; Mopn; Melanopsin; Opsin-4 |
UniProt ID | Q9QXZ9 |
◆ Recombinant Proteins | ||
PRR3-4727R | Recombinant Rat PRR3 Protein | +Inquiry |
PLB1-171H | Recombinant Human PLB1 Protein, His-tagged | +Inquiry |
SSP-RS05680-0086S | Recombinant Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305 SSP_RS05680 protein, His-tagged | +Inquiry |
FLRT3-1550R | Recombinant Rhesus Macaque FLRT3 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL6428MF | Recombinant Full Length Pyrophosphate-Energized Proton Pump 2(Hppa2) Protein, His-Tagged | +Inquiry |
◆ Native Proteins | ||
TTR-706H | Native Human Transthyretin | +Inquiry |
Actin-21R | Native Rabbit Actin Protein | +Inquiry |
C-type lectin like protein-043H | Native Hen C-type lectin like protein Protein, Peroxidase conjugated | +Inquiry |
ALB-7995H | Native Human Serum Albumin(Protease Free) | +Inquiry |
Apotransferrin-39H | Native Human Apotransferrin | +Inquiry |
◆ Cell & Tissue Lysates | ||
C17orf39-8238HCL | Recombinant Human C17orf39 293 Cell Lysate | +Inquiry |
CSNK1E-7240HCL | Recombinant Human CSNK1E 293 Cell Lysate | +Inquiry |
DCLK1-001HCL | Recombinant Human DCLK1 cell lysate | +Inquiry |
TMEM183B-980HCL | Recombinant Human TMEM183B 293 Cell Lysate | +Inquiry |
CSTF2T-415HCL | Recombinant Human CSTF2T cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Q&As (0)
Ask a questionAsk a Question for All Opn4 Products
Required fields are marked with *
My Review for All Opn4 Products
Required fields are marked with *
0
Inquiry Basket