Recombinant Full Length Human MDK Protein, C-Flag-tagged
Cat.No. : | MDK-1214HFL |
Product Overview : | Recombinant Full Length Human MDK Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of a small family of secreted growth factors that binds heparin and responds to retinoic acid. The encoded protein promotes cell growth, migration, and angiogenesis, in particular during tumorigenesis. This gene has been targeted as a therapeutic for a variety of different disorders. Alternatively spliced transcript variants encoding multiple isoforms have been observed. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 15.4 kDa |
AA Sequence : | MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRC RVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGK GKDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein, Transmembrane |
Full Length : | Full L. |
Gene Name | MDK midkine [ Homo sapiens (human) ] |
Official Symbol | MDK |
Synonyms | MK; ARAP; NEGF2 |
Gene ID | 4192 |
mRNA Refseq | NM_001012333.3 |
Protein Refseq | NP_001012333.1 |
MIM | 162096 |
UniProt ID | P21741 |
◆ Recombinant Proteins | ||
MDK-5862H | Recombinant Human MDK Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
MDK-441H | Recombinant Human MDK protein, His-tagged | +Inquiry |
Mdk-124M | Active Recombinant Mouse Mdk Protein | +Inquiry |
MDK-442H | Recombinant Human MDK protein, GST-tagged | +Inquiry |
MDK-553H | Recombinant Human MDK protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
MDK-568HCL | Recombinant Human MDK cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All MDK Products
Required fields are marked with *
My Review for All MDK Products
Required fields are marked with *
0
Inquiry Basket