Description :	This gene encodes a member of a small family of secreted growth factors that binds heparin and responds to retinoic acid. The encoded protein promotes cell growth, migration, and angiogenesis, in particular during tumorigenesis. This gene has been targeted as a therapeutic for a variety of different disorders. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Jul 2012]
Source :	E. coli
Species :	Human
Tag :	Non
Form :	Powder
Bio-activity :	Determined by its ability to chemoattract human neutrophils using a concentration range of 0.1-10.0 ng/mL.
Molecular Mass :	13.4 kDa
AA Sequence :	VAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCGVGFREGTCGAQTQRIRCRVPCNWKKEFGADCKYKFENWGACDGGTGTKVRQGTLKKARYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
Purity :	≥ 98% by SDS-PAGE gel and HPLC analyses
Applications :	FuncSt, SDS-PAGE
Storage :	Lyophilized protein should be stored at -20°C or -80°C. After reconstitution, aliquot and store at -20°C or -80°C for up to one month. Storage in frost free freezers is not recommended. Avoid repeated freeze/thaw cycles. Suggest spin the vial prior to opening.

Gene Name	MDK midkine (neurite growth-promoting factor 2) [ Homo sapiens ]
Official Symbol	MDK
Synonyms	MDK; midkine (neurite growth-promoting factor 2); NEGF2; midkine; FLJ27379; MK; ARAP; amphiregulin-associated protein; midgestation and kidney protein; neurite outgrowth-promoting protein; neurite outgrowth-promoting factor 2;
Gene ID	4192
mRNA Refseq	NM_001012333
Protein Refseq	NP_001012333
MIM	162096
UniProt ID	P21741