Recombinant Full Length Human LDHB Protein, GST-tagged
Cat.No. : | LDHB-6968HF |
Product Overview : | Recombinant Human full-length LDHB(1 a.a. - 334 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ. |
- Specification
- Gene Information
- Related Products
- Download
Description : | This gene encodes an enzyme which catalyzes the reversible conversion of lactate and pyruvate, and NAD and NADH, in the glycolytic pathway. Mutations in this gene are associated with lactate dehydrogenase B deficiency. Pseudogenes have been identified on the X chromosome and on chromosome. Multiple alternatively spliced variants, encoding the same protein, have been identified. |
Source : | In Vitro Cell Free System |
Species : | Human |
Tag : | GST |
Molecular Mass : | 62.48 kDa |
Protein length : | 334 amino acids |
AA Sequence : | MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQT PKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWK LSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDS ENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARG LTSDINQKLKDDEVAQLKKSADTLWDIQKDLKDL |
Applications : | ELISA; WB-Re; AP; Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | LDHB lactate dehydrogenase B [ Homo sapiens (human) ] |
Official Symbol | LDHB |
Synonyms | LDHB; lactate dehydrogenase B; LDH-H; TRG-5; L-lactate dehydrogenase B chain; LDH-B; LDH heart subunit; OTTHUMP00000165231; renal carcinoma antigen NY-REN-46; EC 1.1.1.27 |
Gene ID | 3945 |
mRNA Refseq | NM_001174097 |
Protein Refseq | NP_001167568 |
MIM | 150100 |
UniProt ID | P07195 |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LDHB Products
Required fields are marked with *
My Review for All LDHB Products
Required fields are marked with *
0
Inquiry Basket