Recombinant Human LDHB, GST-tagged

• Cat.No.: LDHB-257H
• Product Overview: Recombinant Human LDHB(1 a.a. - 334 a.a.), fused with GST-tag at N-terminal, was expressed in wheat germ.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: GST
• Description: This gene encodes an enzyme which catalyzes the reversible conversion of lactate and pyruvate, and NAD and NADH, in the glycolytic pathway. Mutations in this gene are associated with lactate dehydrogenase B deficiency. Pseudogenes have been identified on the X chromosome and on chromosome. Multiple alternatively spliced variants, encoding the same protein, have been identified.
• Molecular Mass: 62.48 kDa
• AA Sequence: MATLKEKLIAPVAEEEATVPNNKITVVGVGQVGMACAISILGKSLADELALVDVLEDKLKGEMMDLQHGSLFLQT PKIVADKDYSVTANSKIVVVTAGVRQQEGESRLNLVQRNVNVFKFIIPQIVKYSPDCIIIVVSNPVDILTYVTWK LSGLPKHRVIGSGCNLDSARFRYLMAEKLGIHPSSCHGWILGEHGDSSVAVWSGVNVAGVSLQELNPEMGTDNDS ENWKEVHKMVVESAYEVIKLKGYTNWAIGLSVADLIESMLKNLSRIHPVSTMVKGMYGIENEVFLSLPCILNARG LTSDINQKLKDDEVAQLKKSADTLWDIQKDLKDL
• Applications: ELISA; WB-Re; AP; Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80ºC. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: LDHB lactate dehydrogenase B [ Homo sapiens (human) ]
• Official Symbol: LDHB
• Synonyms: LDHB; lactate dehydrogenase B; LDH-H; TRG-5; L-lactate dehydrogenase B chain; LDH-B; LDH heart subunit; OTTHUMP00000165231; renal carcinoma antigen NY-REN-46; EC 1.1.1.27
• Gene ID: 3945
• mRNA Refseq: NM_001174097
• Protein Refseq: NP_001167568
• MIM: 150100
• UniProt ID: P07195
• Chromosome Location: 12p12.2-p12.1
• Pathway: Abnormal metabolism in phenylketonuria; Cysteine and methionine metabolism; Glycolysis / Gluconeogenesis; Propanoate metabolism
• Function: L-lactate dehydrogenase activity; NAD binding; identical protein binding; kinase binding