Recombinant Full Length Human LCN2 Protein, C-Flag-tagged
Cat.No. : | LCN2-1454HFL |
Product Overview : | Recombinant Full Length Human LCN2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a protein that belongs to the lipocalin family. Members of this family transport small hydrophobic molecules such as lipids, steroid hormones and retinoids. The protein encoded by this gene is a neutrophil gelatinase-associated lipocalin and plays a role in innate immunity by limiting bacterial growth as a result of sequestering iron-containing siderophores. The presence of this protein in blood and urine is an early biomarker of acute kidney injury. This protein is thought to be be involved in multiple cellular processes, including maintenance of skin homeostasis, and suppression of invasiveness and metastasis. Mice lacking this gene are more susceptible to bacterial infection than wild type mice. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 22.4 kDa |
AA Sequence : | MPLGLLWLGLALLGALHAQAQDSTSDLIPAPPLSKVPLQQNFQDNQFQGKWYVVGLAGNAILREDKDPQK MYATIYELKEDKSYNVTSVLFRKKKCDYWIRTFVPGCQPGEFTLGNIKSYPGLTSYLVRVVSTNYNQHAM VFFKKVSQNREYFKITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDGTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | LCN2 lipocalin 2 [ Homo sapiens (human) ] |
Official Symbol | LCN2 |
Synonyms | p25; 24p3; MSFI; NGAL |
Gene ID | 3934 |
mRNA Refseq | NM_005564.5 |
Protein Refseq | NP_005555.2 |
MIM | 600181 |
UniProt ID | P80188 |
◆ Recombinant Proteins | ||
LCN2-1026H | Active Recombinant Human NGAL Protein | +Inquiry |
LCN2-6896P | Recombinant Pig LCN2 protein, His & T7-tagged | +Inquiry |
Lcn2-1302M | Recombinant Mouse Lcn2 Protein, MYC/DDK-tagged | +Inquiry |
LCN2-797M | Recombinant Mouse LCN2 Protein (Met1-Asn200) | +Inquiry |
LCN2-2574H | Active Recombinant Human LCN2 protein | +Inquiry |
◆ Native Proteins | ||
LCN2-384H | Native Human LCN2 | +Inquiry |
◆ Cell & Tissue Lysates | ||
LCN2-2781MCL | Recombinant Mouse LCN2 cell lysate | +Inquiry |
LCN2-538RCL | Recombinant Rat LCN2 cell lysate | +Inquiry |
LCN2-2895HCL | Recombinant Human LCN2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All LCN2 Products
Required fields are marked with *
My Review for All LCN2 Products
Required fields are marked with *
0
Inquiry Basket