Recombinant Full Length Human Kit Ligand(Kitlg) Protein, His-Tagged

• Cat.No.: RFL23935HF
• Product Overview: Recombinant Full Length Human Kit ligand(KITLG) Protein (P21583) (26-273aa), fused to N-terminal His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: Full Length of Mature Protein (26-273)
• Form: Lyophilized powder
• AA Sequence: EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVAASSLRNDSSSSNRKAKNPPGDSSLHWAAMALPALFSLIIGFAFGALYWKKRQPSLTRAVENIQINEEDNEISMLQEKEREFQEV
• Purity: Greater than 90% as determined by SDS-PAGE.
• Applications: SDS-PAGE
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
• Storage: Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles.
• Storage Buffer: Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Gene Information

• Gene Name: KITLG
• Synonyms: C kit ligand; C-kit ligand; Ckit ligand; DCUA; DFNA69; DKFZp686F2250; familial progressive hyperpigmentation 2; FPH2; FPHH; KIT ligand; Kitl; KITLG; KL 1; KL1; Mast cell growth factor; MGF; MGF stem cell factor; SCF; SCF_HUMAN; SF; SHEP7; sKITLG; Soluble
• UniProt ID: P21583