Recombinant Full Length Human IRF9 Protein, GST-tagged

• Cat.No.: IRF9-5763HF
• Product Overview: Human ISGF3G full-length ORF ( AAH35716, 1 a.a. - 393 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 393 amino acids
• Description: IRF9 (Interferon Regulatory Factor 9) is a Protein Coding gene. Diseases associated with IRF9 include Skin Papilloma and Hepatitis C. Among its related pathways are Type I Interferon Signaling Pathways and Immune response IFN alpha/beta signaling pathway. GO annotations related to this gene include transcription factor activity, sequence-specific DNA binding and regulatory region DNA binding. An important paralog of this gene is IRF4.
• Molecular Mass: 68.97 kDa
• AA Sequence: MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYKEGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSSERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEFLLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGILVASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLNFWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLV
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: IRF9 interferon regulatory factor 9 [ Homo sapiens ]
• Official Symbol: IRF9
• Synonyms: IRF9; interferon regulatory factor 9; interferon stimulated transcription factor 3, gamma (48kD) , interferon stimulated transcription factor 3, gamma 48kDa , ISGF3G; ISGF-3 gamma; ISGF3 p48 subunit; interferon-stimulated gene factor 3 gamma; transcriptional regulator ISGF3 subunit gamma; IFN-alpha-responsive transcription factor subunit; interferon-stimulated transcription factor 3, gamma 48kDa; interferon-stimulated transcription factor 3, gamma (48kD); p48; IRF-9; ISGF3; ISGF3G
• Gene ID: 10379
• mRNA Refseq: NM_006084
• Protein Refseq: NP_006075
• MIM: 147574
• UniProt ID: Q00978