Recombinant Full Length Human IRF9 Protein, C-Flag-tagged
Cat.No. : | IRF9-1758HFL |
Product Overview : | Recombinant Full Length Human IRF9 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the interferon regulatory factor (IRF) family, a group of transcription factors with diverse roles, including virus-mediated activation of interferon, and modulation of cell growth, differentiation, apoptosis, and immune system activity. Members of the IRF family are characterized by a conserved N-terminal DNA-binding domain containing tryptophan (W) repeats. Mutations in this gene result in Immunodeficiency 65. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 43.5 kDa |
AA Sequence : | MASGRARCTRKLRNWVVEQVESGQFPGVCWDDTAKTMFRIPWKHAGKQDFREDQDAAFFKAWAIFKGKYK EGDTGGPAVWKTRLRCALNKSSEFKEVPERGRMDVAEPYKVYQLLPPGIVSGQPGTQKVPSKRQHSSVSS ERKEEEDAMQNCTLSPSVLQDSLNNEEEGASGGAVHSDIGSSSSSSSPEPQEVTDTTEAPFQGDQRSLEF LLPPEPDYSLLLTFIYNGRVVGEAQVQSLDCRLVAEPSGSESSMEQVLFPKPGPLEPTQRLLSQLERGIL VASNPRGLFVQRLCPIPISWNAPQAPPGPGPHLLPSNECVELFRTAYFCRDLVRYFQGLGPPPKFQVTLN FWEESHGSSHTPQNLITVKMEQAFARYLLEQTPEQQAAILSLVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transcription Factors |
Protein Pathways : | Jak-STAT signaling pathway |
Full Length : | Full L. |
Gene Name | IRF9 interferon regulatory factor 9 [ Homo sapiens (human) ] |
Official Symbol | IRF9 |
Synonyms | p48; IRF-9; ISGF3; ISGF3G |
Gene ID | 10379 |
mRNA Refseq | NM_006084.5 |
Protein Refseq | NP_006075.3 |
MIM | 147574 |
UniProt ID | Q00978 |
◆ Recombinant Proteins | ||
IRF9-376C | Recombinant Cynomolgus Monkey IRF9 Protein, His (Fc)-Avi-tagged | +Inquiry |
IRF9-11731Z | Recombinant Zebrafish IRF9 | +Inquiry |
IRF9-3631H | Recombinant Human IRF9 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
IRF9-3413H | Recombinant Human IRF9 Protein (Met1-Val393), His tagged | +Inquiry |
IRF9-630C | Recombinant Cynomolgus IRF9 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
IRF9-5158HCL | Recombinant Human IRF9 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IRF9 Products
Required fields are marked with *
My Review for All IRF9 Products
Required fields are marked with *
0
Inquiry Basket