Recombinant Full Length Human INSL4 Protein, GST-tagged

• Cat.No.: INSL4-5984HF
• Product Overview: Human INSL4 full-length ORF ( AAH26254, 26 a.a. - 139 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• ProteinLength: 26-139 amino acids
• Description: INSL4 encodes the insulin-like 4 protein, a member of the insulin superfamily. INSL4 encodes a precursor that undergoes post-translational cleavage to produce 3 polypeptide chains, A-C, that form tertiary structures composed of either all three chains, or just the A and B chains. Expression of INSL4 products occurs within the early placental cytotrophoblast and syncytiotrophoblast. [provided by RefSeq
• Molecular Mass: 38.28 kDa
• AA Sequence: AELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGTTSEFIPNLSPELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCCEVICDDGTSVKLCT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: INSL4 insulin-like 4 (placenta) [ Homo sapiens ]
• Official Symbol: INSL4
• Synonyms: INSL4; insulin-like 4 (placenta); early placenta insulin-like peptide; EPIL; insulin-like peptide 4; early placenta insulin-like peptide (EPIL); PLACENTIN
• Gene ID: 3641
• mRNA Refseq: NM_002195
• Protein Refseq: NP_002186
• MIM: 600910
• UniProt ID: Q14641