Recombinant Human INSL4, His-tagged

• Cat.No.: INSL4-118H
• Product Overview: Recombinant Human Early Placenta Insulin-Like Peptide/INSL4 is produced by our mammalian expression system in human cells. The target protein is expressed with sequence (Ala26-Thr139) of Human INSL4 fused with a 6His tag at the C-terminus.

Specification

• Species: Human
• Source: HEK293
• Tag: His
• ProteinLength: 26-139 a.a.
• Description: Early Placenta Insulin-Like Peptide (INSL4) belongs to the insulin family. INSL4 is expressed in the early placental cytotrophoblast and syncytiotrophoblast INSL4 is a secreted protein and a precursor that undergoes post-translational cleavage to produce 3 polypeptide chains, A-C, that form tertiary structures composed of either all three chains, or just the A and B chains. INSL4 plays an important role in the development of trophoblast and in the regulation of bone formation.
• AA Sequence: AELRGCGPRFGKHLLSYCPMPEKTFTTTPGGWLLESGRPKEMVSTSNNKDGQALGTTSEFIPNLS PELKKPLSEGQPSLKKIILSRKKRSGRHRFDPFCCEVICDDGTSVKLCTVDHHHHHH
• Endotoxin: Less than 0.1 ng/μg (1 IEU/μg).
• Purity: Greater than 95% as determined by reducing SDS-PAGE.

Gene Information

• Gene Name: INSL4 insulin-like 4 (placenta) [ Homo sapiens ]
• Official Symbol: INSL4
• Synonyms: INSL4; insulin-like 4 (placenta); early placenta insulin-like peptide; EPIL; insulin-like peptide 4; early placenta insulin-like peptide (EPIL); PLACENTIN
• Gene ID: 3641
• mRNA Refseq: NM_002195
• Protein Refseq: NP_002186
• MIM: 600910
• UniProt ID: Q14641
• Chromosome Location: 9p24
• Function: hormone activity; insulin-like growth factor receptor binding; receptor binding