Recombinant Full Length Human IFNG Protein, C-Flag-tagged
Cat.No. : | IFNG-72HFL |
Product Overview : | Recombinant Full Length Human IFNG Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a soluble cytokine that is a member of the type II interferon class. The encoded protein is secreted by cells of both the innate and adaptive immune systems. The active protein is a homodimer that binds to the interferon gamma receptor which triggers a cellular response to viral and microbial infections. Mutations in this gene are associated with an increased susceptibility to viral, bacterial and parasitic infections and to several autoimmune diseases. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 16.7 kDa |
AA Sequence : | MKYTSYILAFQLCIVLGSLGCYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQS QIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVM AELSPAAKTGKRKRSQMLFRGRRASQTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Protein Pathways : | Allograft rejection, Cytokine-cytokine receptor interaction, Graft-versus-host disease, Jak-STAT signaling pathway, Natural killer cell mediated cytotoxicity, Proteasome, Regulation of autophagy, Systemic lupus erythematosus, T cell receptor signaling pathway, TGF-beta signaling pathway, Type I diabetes mellitus |
Full Length : | Full L. |
Gene Name | IFNG interferon gamma [ Homo sapiens (human) ] |
Official Symbol | IFNG |
Synonyms | IFG; IFI; IMD69 |
Gene ID | 3458 |
mRNA Refseq | NM_000619.3 |
Protein Refseq | NP_000610.2 |
MIM | 147570 |
UniProt ID | P01579 |
◆ Recombinant Proteins | ||
IFNG-579H | Recombinant Human IFNG protein, His-Avi-tagged | +Inquiry |
IFNG-8665H | Recombinant Human IFNG protein, hFc-Flag-tagged | +Inquiry |
Ifng-119M | Recombinant Mouse Ifng protein(Met1-Cys155), hFc-tagged | +Inquiry |
Ifng-42M | Active Recombinant Mouse Ifng Protein (His23-Cys155), C-His tagged, Animal-free, Carrier-free | +Inquiry |
Ifng-510M | Active Recombinant Mouse Ifng protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
IFNG-1007FCL | Recombinant Ferret IFNG cell lysate | +Inquiry |
IFNG-1797MCL | Recombinant Mouse IFNG cell lysate | +Inquiry |
IFNG-001HCL | Recombinant Human IFNG cell lysate | +Inquiry |
IFNG-1536RCL | Recombinant Rat IFNG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All IFNG Products
Required fields are marked with *
My Review for All IFNG Products
Required fields are marked with *
0
Inquiry Basket