Recombinant Full Length Human HTR4 Protein

• Cat.No.: HTR4-5694HF
• Product Overview: Human HTR4 full-length ORF (NP_000861.1) recombinant protein without tag.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 139 amino acids
• Description: This gene is a member of the family of serotonin receptors, which are G protein coupled receptors that stimulate cAMP production in response to serotonin (5-hydroxytryptamine). The gene product is a glycosylated transmembrane protein that functions in both the peripheral and central nervous system to modulate the release of various neurotransmitters. Multiple transcript variants encoding proteins with distinct C-terminal sequences have been described, but the full-length nature of some transcript variants has not been determined. [provided by RefSeq
• Form: Liquid
• Molecular Mass: 43.8 kDa
• AA Sequence: MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT
• Applications: Antibody Production
  Functional Study
  Compound Screening
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 25 mM Tris-HCl of pH8.0 containing 2% glycerol.

Gene Information

• Gene Name: HTR4 5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled [ Homo sapiens ]
• Official Symbol: HTR4
• Synonyms: HTR4; 5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 4; 5-hydroxytryptamine receptor 4; 5 HT4; cardiac 5-HT4 receptor; 5-HT4; 5-HT4R
• Gene ID: 3360
• mRNA Refseq: NM_000870
• Protein Refseq: NP_000861
• MIM: 602164
• UniProt ID: Q13639