Recombinant Human HTR4 Protein

Cat.No. : HTR4-5238H
Product Overview : Human HTR4 full-length ORF (NP_000861.1) recombinant protein without tag.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Description : This gene is a member of the family of serotonin receptors, which are G protein coupled receptors that stimulate cAMP production in response to serotonin (5-hydroxytryptamine). The gene product is a glycosylated transmembrane protein that functions in both the peripheral and central nervous system to modulate the release of various neurotransmitters. Multiple transcript variants encoding proteins with distinct C-terminal sequences have been described, but the full-length nature of some transcript variants has not been determined. [provided by RefSeq
Form : Liquid
Molecular Mass : 43.8 kDa
AA Sequence : MDKLDANVSSEEGFGSVEKVVLLTFLSTVILMAILGNLLVMVAVCWDRQLRKIKTNYFIVSLAFADLLVSVLVMPFGAIELVQDIWIYGEVFCLVRTSLDVLLTTASIFHLCCISLDRYYAICCQPLVYRNKMTPLRIALMLGGCWVIPTFISFLPIMQGWNNIGIIDLIEKRKFNQNSNSTYCVFMVNKPYAITCSVVAFYIPFLLMVLAYYRIYVTAKEHAHQIQMLQRAGASSESRPQSADQHSTHRMRTETKAAKTLCIIMGCFCLCWAPFFVTNIVDPFIDYTVPGQVWTAFLWLGYINSGLNPFLYAFLNKSFRRAFLIILCCDDERYRRPSILGQTVPCSTTTINGSTHVLRDAVECGGQWESQCHPPATSPLVAAQPSDT
Applications : Antibody Production
Functional Study
Compound Screening
Usage : Heating may cause protein aggregation. Please do not heat this product before electrophoresis.
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 25 mM Tris-HCl of pH8.0 containing 2% glycerol.
Gene Name HTR4 5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled [ Homo sapiens ]
Official Symbol HTR4
Synonyms HTR4; 5-hydroxytryptamine (serotonin) receptor 4, G protein-coupled; 5 hydroxytryptamine (serotonin) receptor 4; 5-hydroxytryptamine receptor 4; 5 HT4; cardiac 5-HT4 receptor; 5-HT4; 5-HT4R;
Gene ID 3360
mRNA Refseq NM_000870
Protein Refseq NP_000861
MIM 602164
UniProt ID Q13639

Not For Human Consumption!

Inquiry

  • Reviews
  • Q&As

Customer Reviews (0)

Write a review

Q&As (0)

Ask a question

Ask a Question for All HTR4 Products

Required fields are marked with *

My Review for All HTR4 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon