Recombinant Full Length Human HSCB Protein, GST-tagged

• Cat.No.: HSCB-3706HF
• Product Overview: Human HSCB full-length ORF ( NP_741999.3, 1 a.a. - 235 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Description: This gene encodes a DnaJ-type co-chaperone and member of the heat shock cognate B (HscB) family of proteins. The encoded protein plays a role in the synthesis of iron-sulfur clusters, protein cofactors that are involved in the redox reactions of mitochondrial electron transport and other processes. Cells in which this gene is knocked down exhibit reduced activity of iron-sulfur cluster-dependent enzymes including succinate dehydrogenase and aconitase. The encoded protein may stimulate the ATPase activity of the mitochondrial stress-70 protein. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2015]
• Source: In Vitro Cell Free System
• Species: Human
• Tag: GST
• Molecular Mass: 53.8 kDa
• Protein length: 235 amino acids
• AA Sequence: MWRGRAGALLRVWGFWPTGVPRRRPLSCDAASQAGSNYPRCWNCGGPWGPGREDRFFCPQCRALQAPDPTRDYFSLMDCNRSFRVDTAKLQHRYQQLQRLVHPDFFSQRSQTEKDFSEKHSTLVNDAYKTLLAPLSRGLYLLKLHGIEIPERTDYEMDRQFLIEIMEINEKLAEAESEAAMKEIESIVKAKQKEFTDNVSSAFEQDDFEEAKEILTKMRYFSNIEEKIKLKKIPL
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: HSCB HscB iron-sulfur cluster co-chaperone homolog (E. coli) [ Homo sapiens ]
• Official Symbol: HSCB
• Synonyms: HSCB; HscB iron-sulfur cluster co-chaperone homolog (E. coli); JAC1; HSC20; DNAJC20; dJ366L4.2; iron-sulfur cluster co-chaperone protein HscB, mitochondrial; J-type co-chaperone HSC20; dnaJ homolog subfamily C member 20; DnaJ (Hsp40) homolog, subfamily C, member 20; Jac1
• Gene ID: 150274
• mRNA Refseq: NM_172002
• Protein Refseq: NP_741999
• MIM: 608142
• UniProt ID: Q8IWL3