Recombinant Full Length Human HRG Protein, C-Flag-tagged
Cat.No. : | HRG-799HFL |
Product Overview : | Recombinant Full Length Human HRG Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This histidine-rich glycoprotein contains two cystatin-like domains and is located in plasma and platelets. The physiological function has not been determined but it is known that the protein binds heme, dyes and divalent metal ions. The encoded protein also has a peptide that displays antimicrobial activity against C. albicans, E. coli, S. aureus, P. aeruginosa, and E. faecalis. It can inhibit rosette formation and interacts with heparin, thrombospondin and plasminogen. Two of the protein's effects, the inhibition of fibrinolysis and the reduction of inhibition of coagulation, indicate a potential prothrombotic effect. Mutations in this gene lead to thrombophilia due to abnormal histidine-rich glycoprotein levels. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 57.6 kDa |
AA Sequence : | MKALIAALLLITLQYSCAVSPTDCSAVEPEAEKALDLINKRRRDGYLFQLLRIADAHLDRVENTTVYYLV LDVQESDCSVLSRKYWNDCEPPDSRRPSEIVIGQCKVIATRHSHESQDLRVIDFNCTTSSVSSALANTKD SPVLIDFFEDTERYRKQANKALEKYKEENDDFASFRVDRIERVARVRGGEGTGYFVDFSVRNCPRHHFPR HPNVFGFCRADLFYDVEALDLESPKNLVINCEVFDPQEHENINGVPPHLGHPFHWGGHERSSTTKPPFKP HGSRDHHHPHKPHEHGPPPPPDERDHSHGPPLPQGPPPLLPMSCSSCQHATFGTNGAQRHSHNNNSSDLH PHKHHSHEQHPHGHHPHAHHPHEHDTHRQHPHGHHPHGHHPHGHHPHGHHPHGHHPHCHDFQDYGPCDPP PHNQGHCCHGHGPPPGHLRRRGPGKGPRPFHCRQIGSVYRLPPLRKGEVLPLPEANFPSFPLPHHKHPLK PDNQPFPQSVSESCPGKFKSGFPQVSMFFTHTFPKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Secreted Protein |
Full Length : | Full L. |
Gene Name | HRG histidine rich glycoprotein [ Homo sapiens (human) ] |
Official Symbol | HRG |
Synonyms | HPRG; HRGP; THPH11 |
Gene ID | 3273 |
mRNA Refseq | NM_000412.5 |
Protein Refseq | NP_000403.1 |
MIM | 142640 |
UniProt ID | P04196 |
◆ Recombinant Proteins | ||
HRG-332H | Recombinant Human Histidine-Rich Glycoprotein | +Inquiry |
HRG-514H | Recombinant Human HRG protein, His-tagged | +Inquiry |
HRG-1098H | Recombinant Human HRG Protein, His (Fc)-Avi-tagged | +Inquiry |
HRG-5032H | Recombinant Human HRG Protein, GST-tagged | +Inquiry |
HRG-2133H | Recombinant Human HRG Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HRG-2790HCL | Recombinant Human HRG cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HRG Products
Required fields are marked with *
My Review for All HRG Products
Required fields are marked with *
0
Inquiry Basket