Recombinant Full Length Human HMGB1 Protein, C-Flag-tagged

• Cat.No.: HMGB1-700HFL
• Product Overview: Recombinant Full Length Human HMGB1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.

Specification

• Product Overview: Recombinant Full Length Human HMGB1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
• Description: This gene encodes a protein that belongs to the High Mobility Group-box superfamily. The encoded non-histone, nuclear DNA-binding protein regulates transcription, and is involved in organization of DNA. This protein plays a role in several cellular processes, including inflammation, cell differentiation and tumor cell migration. Multiple pseudogenes of this gene have been identified. Alternative splicing results in multiple transcript variants that encode the same protein.
• Source: Mammalian cells
• Species: Human
• Tag: Flag
• Form: 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
• Molecular Mass: 24.7 kDa
• AA Sequence: MGKGDPKKPRGKMSSYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWKTMSAKEKGKFEDMAKADKAR YEREMKTYIPPKGETKKKFKDPNAPKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADD KQPYEKKAAKLKEKYEKDIAAYRAKGKPDAAKKGVVKAEKSKKKKEEEEDEEDEEDEEEEEDEEDEDEEE
  DDDDETRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Concentration: >50 ug/mL as determined by microplate BCA method.
• Preparation: Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
• Protein Families: Druggable Genome, Stem cell - Pluripotency, Transcription Factors
• Protein Pathways: Base excision repair
• Full Length: Full L.

Gene Information

• Gene Name: HMGB1 high mobility group box 1 [ Homo sapiens (human) ]
• Official Symbol: HMGB1
• Synonyms: HMG1; HMG3; HMG-1; SBP-1
• Gene ID: 3146
• mRNA Refseq: NM_002128.7
• Protein Refseq: NP_002119.1
• MIM: 163905
• UniProt ID: P09429