Recombinant Full Length Human HLF Protein, GST-tagged
Cat.No. : | HLF-3633HF |
Product Overview : | Human HLF full-length ORF ( AAH36093, 1 a.a. - 295 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 295 amino acids |
Description : | This gene encodes a member of the proline and acidic-rich (PAR) protein family, a subset of the bZIP transcription factors. The encoded protein forms homodimers or heterodimers with other PAR family members and binds sequence-specific promoter elements to activate transcription. Chromosomal translocations fusing portions of this gene with the E2A gene cause a subset of childhood B-lineage acute lymphoid leukemias. Alternatively spliced transcript variants have been described, but their biological validity has not been determined. [provided by RefSeq |
Molecular Mass : | 58.19 kDa |
AA Sequence : | MEKMSRPLPLNPTFIPPPYGVLRSLLENPLKLPLHHEDAFSKDKDKEKKLDDESNSPTVPQSAFLGPTLWDKTLPYDGDTFQLEYMDLEEFLSENGIPPSPSQHDHSPHPPGLQPASSAAPSVMDLSSRASAPLHPGIPSPNCMQSPIRPGQLLPANRNTPSPIDPDTIQVPVGYEPDPADLALSSIPGQEMFDPRKRKFSEEELKPQPMIKKARKVFIPDDLKDDKYWARRRKNNMAAKRSRDARRLKENQIAIRASFLEKENSALRQEVADLRKELGKCKNILAKYEARHGPL |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | HLF hepatic leukemia factor [ Homo sapiens ] |
Official Symbol | HLF |
Synonyms | HLF; hepatic leukemia factor; MGC33822; |
Gene ID | 3131 |
mRNA Refseq | NM_002126 |
Protein Refseq | NP_002117 |
MIM | 142385 |
UniProt ID | Q16534 |
◆ Recombinant Proteins | ||
HLF-3633HF | Recombinant Full Length Human HLF Protein, GST-tagged | +Inquiry |
HLF-1924R | Recombinant Rhesus Macaque HLF Protein, His (Fc)-Avi-tagged | +Inquiry |
HLF-209H | Recombinant Human HLF protein, T7/His-tagged | +Inquiry |
HLF-2103R | Recombinant Rhesus monkey HLF Protein, His-tagged | +Inquiry |
HLF-5023H | Recombinant Human Hepatic Leukemia Factor, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
HLF-5490HCL | Recombinant Human HLF 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All HLF Products
Required fields are marked with *
My Review for All HLF Products
Required fields are marked with *
0
Inquiry Basket